Align glutamate/glutamine/aspartate/asparagine transport system permease protein BztB (characterized)
to candidate Dsui_0637 Dsui_0637 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= CharProtDB::CH_011913 (426 letters) >FitnessBrowser__PS:Dsui_0637 Length = 224 Score = 95.1 bits (235), Expect = 2e-24 Identities = 58/156 (37%), Positives = 90/156 (57%), Gaps = 2/156 (1%) Query: 259 LFAPISALLYGLGFHLDYPQITKFDFTGGFQMLHSFTALLIALTLYTAAFIAEIVRAGIQ 318 LF + ++ L F+L PQ K F + +AL +A L+ AA+ +EI+RAGIQ Sbjct: 62 LFRSVPLVMVILWFYLIVPQALKGLFGQDIGDIRLVSAL-VAFALFEAAYYSEIIRAGIQ 120 Query: 319 AISRGQTEAAYALGLRPGRTMSLVILPQALRVIVPPLISQFLNLTKNSSLAIAVSYMDLR 378 ++ +GQ A ALGL PG+TM LV+LPQA R ++P L++Q + L +++SL + D Sbjct: 121 SVPKGQVAAGLALGLTPGQTMRLVVLPQAFRNMIPLLLTQAIILFQDTSLVYVIGLSDFF 180 Query: 379 GTLGGITLNQTGRELECMLLMMLIYLTISLTISSLM 414 GT + ++ GR +E +L Y I T+S L+ Sbjct: 181 GTAYKVG-DRDGRLVELLLFAGAAYFVICFTVSRLV 215 Score = 42.4 bits (98), Expect = 1e-08 Identities = 22/56 (39%), Positives = 36/56 (64%) Query: 90 EGLLNTLLVSVLGCILATILGTIIGVLRLSQNWLVARIMTVYVETFRNIPLLLWIL 145 +GLL TL V++ ++ GT++ V RLS N L++ + YV FR++PL++ IL Sbjct: 18 KGLLVTLEVTLTAIVVGIGWGTLLAVARLSSNRLLSFLAAGYVNLFRSVPLVMVIL 73 Lambda K H 0.326 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 426 Length of database: 224 Length adjustment: 27 Effective length of query: 399 Effective length of database: 197 Effective search space: 78603 Effective search space used: 78603 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory