Align Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale)
to candidate Dsui_0637 Dsui_0637 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= uniprot:Q31RN9 (396 letters) >FitnessBrowser__PS:Dsui_0637 Length = 224 Score = 131 bits (329), Expect = 2e-35 Identities = 74/206 (35%), Positives = 121/206 (58%), Gaps = 7/206 (3%) Query: 190 GLLLTLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTILFFGQVM 249 GLL+TL L ++V + G LLA+ R SS + +L+ Y+ LFR +PLV ++ + ++ Sbjct: 19 GLLVTLEVTLTAIVVGIGWGTLLAVARLSSNRLLSFLAAGYVNLFRSVPLVMVILWFYLI 78 Query: 250 VPLMLDSEWRID----RILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGLNLF 305 VP L + D R++ A+V +F +AY +E +R G+Q++P+GQ A ALGL Sbjct: 79 VPQALKGLFGQDIGDIRLVSALVAFALFEAAYYSEIIRAGIQSVPKGQVAAGLALGLTPG 138 Query: 306 QTYRFIVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYLGRYAE 365 QT R +VLPQA R IP ++ + L QDT+L+ ++GL + G + + GR E Sbjct: 139 QTMRLVVLPQAFRNMIPLLLTQAIILFQDTSLVYVIGLSDFFGTAYKVGDRD---GRLVE 195 Query: 366 VYLFLGVLYWLCCYGLAQLSRRLEQR 391 + LF G Y++ C+ +++L + L+ R Sbjct: 196 LLLFAGAAYFVICFTVSRLVKHLQAR 221 Lambda K H 0.329 0.142 0.471 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 224 Length adjustment: 26 Effective length of query: 370 Effective length of database: 198 Effective search space: 73260 Effective search space used: 73260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory