Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate Dsui_0636 Dsui_0636 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= SwissProt::P0AER5 (224 letters) >FitnessBrowser__PS:Dsui_0636 Length = 245 Score = 112 bits (280), Expect = 6e-30 Identities = 67/233 (28%), Positives = 128/233 (54%), Gaps = 12/233 (5%) Query: 2 YEFDWSSIVPSLP--------YLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVA 53 Y ++WS + +P +L GL T+ ++++A VI ++ G+++ V+R ++ Sbjct: 3 YNWNWSVFLTPVPSGETTYLGWLFTGLQWTVALSLSAWVIALVVGSIVGVLRTVPNRWLS 62 Query: 54 WFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLI----SAMVAFSMFEA 109 FA YV FR++PL++ L +Y ++P L LG + K L+ +AM+ +F A Sbjct: 63 GFAAVYVECFRNVPLLVQLFSWYFVLPELLPPALGNAYKQSDPLLQQFLAAMLCLGLFTA 122 Query: 110 AYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDT 169 A +E +RAGI+S+ RGQ +A LA+G T Q + ++LP AFR +VP L ++ + +F+++ Sbjct: 123 ARVAEQVRAGIESLPRGQRNAGLAMGFTLAQVYRHVLLPMAFRIIVPPLTSEFLNIFKNS 182 Query: 170 SLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR 222 ++ + L + R A + + E + +Y I+++ L+ L+ + Sbjct: 183 AVATTIGLIELSRQAQQLVDYTAQPYEAFIAVTLLYVCINVTVMFLMRRLEEK 235 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 245 Length adjustment: 23 Effective length of query: 201 Effective length of database: 222 Effective search space: 44622 Effective search space used: 44622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory