Align CbtF, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate Dsui_2799 Dsui_2799 oligopeptide/dipeptide ABC transporter, ATP-binding protein
Query= TCDB::Q97VF4 (324 letters) >FitnessBrowser__PS:Dsui_2799 Length = 670 Score = 177 bits (450), Expect = 5e-49 Identities = 112/309 (36%), Positives = 173/309 (55%), Gaps = 16/309 (5%) Query: 3 LMELKGVSVIFEDKVGLFKKRKFY--ALKDVSLSMNQGDLLIVLGESGAGKTTLGRVIVG 60 L+ + + V F + GLFK+ + A+ VSL + +G L ++GESG GKTT G+ ++ Sbjct: 351 LLAVGELKVHFPIRKGLFKRTVGHVKAVDGVSLELQRGRTLALVGESGCGKTTAGKAVLR 410 Query: 61 LQKPTSGEVVYDGYNIWKNKRKIFKKYRKDVQLIPQDPYSTLPFNKTVEEILVAPILRWE 120 L P +G V DG + + K R+ +Q++ QDP+++L TV EI+ + Sbjct: 411 LL-PATGSVRLDGRELLGLPERELKPLRRRMQMVFQDPFASLNPRLTVGEIIEEGMTALR 469 Query: 121 -KINKDELRKRLINLLELVKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADE 179 ++DE R L LLE V L PAE LG+YPH+ SGGQ+QR++IAR+L+V P ++V DE Sbjct: 470 VAASRDERRAALAALLESVGL-PAEA-LGRYPHEFSGGQRQRIAIARALAVQPELLVCDE 527 Query: 180 PVTMVDASLRIGILNTLAEIKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVE 239 P + +D S++ ILN L ++ L L +FITH+ + Y H + VM+ GRIVE Sbjct: 528 PTSALDVSVQAQILNLLRRLQEELGLAYLFITHNFAVVEYLAH-----DVAVMYLGRIVE 582 Query: 240 RADLEEILKDPLHPYTNDLIKLTPSIDNLYKEINVKINYE-----RVEKGCPYRLRCPFA 294 + ++++L P HPYT L+ P + V++ E R +GC + RC A Sbjct: 583 QGPVQQVLAAPCHPYTRALLSAVPEPRLAGQREMVRLPGETPSPARPPQGCHFHPRCAQA 642 Query: 295 MDICKNEEP 303 + C+ E P Sbjct: 643 SERCRQEYP 651 Score = 130 bits (328), Expect = 7e-35 Identities = 93/303 (30%), Positives = 143/303 (47%), Gaps = 16/303 (5%) Query: 23 RKFYALKDVSLSMNQGDLLIVLGESGAGKTT----LGRVIVGLQKPTSGEVVYDGYNIWK 78 R A+ VS ++ G+ +LGESG GK+ L R++ + GEV +G I Sbjct: 19 RVLTAVDGVSFAVAPGETFALLGESGCGKSATALALLRLLPNAGRIQGGEVWLEGEEILA 78 Query: 79 NKRKIFKKYRKDVQ-LIPQDPYSTLPFNKTVEEILVAPILRWEKINKDELRKRLINLLEL 137 + R +I Q+P ++L T+ + + R + + R+ + LL Sbjct: 79 LPEAAMRDRRGSAAAMIFQEPATSLNPVLTIGRQIGESLERHRGMKGEAARREALALLTA 138 Query: 138 VKLTPAEEFLGKYPHQLSGGQKQRLSIARSLSVNPRIIVADEPVTMVDASLRIGILNTLA 197 V + E L +YP QLSGG KQR IA +L+ PR+++ADEP T +D +++ IL+ LA Sbjct: 139 VGIADPERRLEEYPFQLSGGMKQRAMIAIALAGEPRLLIADEPTTALDVTIQAQILDLLA 198 Query: 198 EIKNRLNLTMVFITHDIPIARYFYHLFDKGNTIVMFAGRIVERADLEEILKDPLHPYTND 257 ++ + M+ ITHD+ + H VM+AG IVE A +E P HPYT Sbjct: 199 RLQAERAMGMLLITHDLGVVARSAH-----RVGVMYAGEIVETAPRQEFFASPRHPYTQK 253 Query: 258 LIKLTPSIDNLYKEI----NVKINYERVEKGCPYRLRCPFAMDICKNEEP--KLFKYSHE 311 L P + ++ + GC + RCP AMD C+ E P + H+ Sbjct: 254 LFAALPDLGQRGAQLATIPGQVPGLAAMPAGCRFAPRCPVAMDRCRLESPGWTELEAGHQ 313 Query: 312 VAC 314 V C Sbjct: 314 VRC 316 Lambda K H 0.321 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 27 Number of successful extensions: 9 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 324 Length of database: 670 Length adjustment: 33 Effective length of query: 291 Effective length of database: 637 Effective search space: 185367 Effective search space used: 185367 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory