Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate Dsui_2068 Dsui_2068 ABC-type metal ion transport system, ATPase component
Query= reanno::pseudo3_N2E3:AO353_03040 (254 letters) >FitnessBrowser__PS:Dsui_2068 Length = 278 Score = 154 bits (388), Expect = 2e-42 Identities = 86/224 (38%), Positives = 133/224 (59%), Gaps = 12/224 (5%) Query: 24 LKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLNNEELKLVANKDGALKAADPK 83 L A G++ IIG SG+GKST LR NLLE+P AG+++++ ++L ++ P Sbjct: 35 LDVAPGEIHGIIGFSGAGKSTLLRLANLLERPDAGQVVVHGQDLMTLS----------PA 84 Query: 84 QLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSKAEAREKAELYLAKVGVSHRK 143 L+ R R+ M+FQHFNL + T +N+ P+ + G +A E+ + L VG+S + Sbjct: 85 DLRTARQRIGMIFQHFNLLHNRTVADNVA-FPLRIAGADEARINERVKTCLEFVGLSEKA 143 Query: 144 DAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPELVGDVLKVMQALAQE-GRTM 202 YP +SGG++QRVAIARALA EP V+L DEPTSALDP +L+V+ + + G T+ Sbjct: 144 GVYPAQLSGGQKQRVAIARALAPEPHVLLADEPTSALDPRTTQSLLEVLADVNRRLGVTI 203 Query: 203 VVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSERLQ 246 ++V+HEMG R + +++ + G + E + P S+ Q Sbjct: 204 LLVSHEMGVIRRLCHRVSVMEAGQIVERLTIANGRIPPDSQLAQ 247 Lambda K H 0.317 0.131 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 278 Length adjustment: 25 Effective length of query: 229 Effective length of database: 253 Effective search space: 57937 Effective search space used: 57937 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory