Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate Dsui_0437 Dsui_0437 succinate-semialdehyde dehydrogenase
Query= BRENDA::P77674 (474 letters) >FitnessBrowser__PS:Dsui_0437 Length = 483 Score = 315 bits (807), Expect = 2e-90 Identities = 185/474 (39%), Positives = 262/474 (55%), Gaps = 7/474 (1%) Query: 1 MQHKLLINGELVSGEGEKQPVYNPATGDVLLEIAEASAEQVDAAVRAADAAFAEWGQTTP 60 ++ + +NG+ V GE + PV+NPA+G L + A + AA+ AADAA+ W T Sbjct: 9 LRQQCYLNGQWVGGESDF-PVHNPASGAELARVPRFGAAETRAAIAAADAAWPAWRSRTA 67 Query: 61 KVRAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNG 120 K R L + +++ ++ A L + GKPL A E+ +FA A+ G Sbjct: 68 KERTGVLRRWFELMNQHADDLALLMTSEQGKPLAEA-RGEVAYAASFVEWFAEEAKRAYG 126 Query: 121 LAAGEYLEGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLT 180 ++ + P+GV A+I PWN+P M K+APALAAG VV+KP+E TPLT Sbjct: 127 ETIPAVAADKRMLVIKQPIGVCAAITPWNFPAAMITRKVAPALAAGCTVVVKPAEQTPLT 186 Query: 181 ALKLAELAKDI-FPAGVINILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASS 239 AL LAELA FPAGV N++ G +G LT +P VR +S TGS G ++ A S Sbjct: 187 ALALAELAHRAGFPAGVFNVITGDPVAIGGELTSNPTVRKLSFTGSTEVGRLLMGQCAPS 246 Query: 240 IKRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEK 299 IK+ +ELGG AP IVFDDAD++A VEG Y N GQ C A R+ Q GIY+ + Sbjct: 247 IKKLSLELGGNAPFIVFDDADLDAAVEGAMISKYRNTGQTCVCANRLLVQDGIYEAFAAR 306 Query: 300 LGAAVATLKSGAPDDESTELGPLSSLAHLERVGKAVEEAKATGHIKVITGG---EKRKGN 356 L A VATLK G + GPL L +V + +A A G +V+ GG E+ + Sbjct: 307 LAAKVATLKVGEGTEAGVTQGPLIDADALAKVEAHIADAVAHG-ARVLAGGRRHERYREG 365 Query: 357 GYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVG 416 G ++ PT+LA + ++E FGPV + F EE+ + AN +++GLAS +++D+G Sbjct: 366 GAFFQPTVLADVTPQMRVAREETFGPVAPLFRFQTEEEAIALANATEFGLASYFYSRDIG 425 Query: 417 RAHRVSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHV 470 R RV L+YG VNT + P GG K SG G++ S YGLE+Y V+++ Sbjct: 426 RIFRVGEALEYGMVGVNTGLISNEVAPFGGIKQSGLGREGSKYGLEEYLEVKYL 479 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 536 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 474 Length of database: 483 Length adjustment: 34 Effective length of query: 440 Effective length of database: 449 Effective search space: 197560 Effective search space used: 197560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory