GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Dechlorosoma suillum PS

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; EC 6.2.1.1; Acetate--CoA ligase; Acyl-activating enzyme (uncharacterized)
to candidate Dsui_2925 Dsui_2925 propionate--CoA ligase

Query= curated2:O93730
         (670 letters)



>lcl|FitnessBrowser__PS:Dsui_2925 Dsui_2925 propionate--CoA ligase
          Length = 630

 Score =  497 bits (1279), Expect = e-145
 Identities = 266/637 (41%), Positives = 402/637 (63%), Gaps = 21/637 (3%)

Query: 32  AYFKFHRQTVENLESFWESVAKELEWFKPWDKVLDASNPPFYKWFVGGRLNLSYLAVDRH 91
           +Y +FHR+++E  ++FW   A+ ++W KP+D+V D S PPF KWFVGG+ NL Y AVDRH
Sbjct: 3   SYKEFHRRSIEQPDAFWSEQAQLIDWHKPFDQVCDYSRPPFAKWFVGGQTNLCYNAVDRH 62

Query: 92  VKTWRKNKLAIEWEGEPVDENGYPTDRRKLTYYDLYREVNRVAYMLKQNFGVKKGDKITL 151
            KT   +   I    E   E  Y       ++ +L REV R+A  + Q+ GVKKGD++ +
Sbjct: 63  AKTRPNDNALIFISTETDVEKVY-------SFAELQREVERMA-AIYQSLGVKKGDRVLI 114

Query: 152 YLPMVPELPITMLAAWRIGAITSVVFSGFSADALAERINDSQSRIVITADGFWRRGRVVR 211
           Y+PM+ E    +LA  RIGAI SVVF GF++ +LA RI+D++  +++++D   R G+ V 
Sbjct: 115 YMPMIAEACFAILACARIGAIHSVVFGGFASGSLATRIDDAKPVLIVSSDAGMRGGKAVP 174

Query: 212 LKEVVDAALEKATGVESVIVLPRLGL-KDVPMTEGRDYWWNKLMQGIPPNAYIEPEPVES 270
            K ++D A+ +A      +++   GL K     EGRD  +  L      +A +    VES
Sbjct: 175 YKHLLDDAINQAEHKPGKVLMVDRGLDKAFNKVEGRDVDYAALRAQFM-DAQVPVTWVES 233

Query: 271 EHPSFILYTSGTTGKPKGIVHDTGGWAVHVYATMKWVFDIRDDDIFWCTADIGWVTGHSY 330
             PS+ILYTSGTTGKPKG+  DTGG+AV + +++K ++  +  + F+ T+DIGWV GHSY
Sbjct: 234 SDPSYILYTSGTTGKPKGVQRDTGGYAVALASSIKHIYCGKPGETFFSTSDIGWVVGHSY 293

Query: 331 VVLGPLLMGATEVIYEGAPDYPQPDRWWSIIERYGVTIFYTSPTAIRMFMRYGEEWPRKH 390
           ++ GPL+ G   ++YEG P  P    WW I+E+Y V + +++PTA R+  ++   +  K+
Sbjct: 294 IIYGPLIGGMATIMYEGTPIRPDAGIWWQIVEKYKVNVMFSAPTAARVLKKHDPAFLHKY 353

Query: 391 DLSTLRIIHSVGEPINPEAWRWAYRVLGNEKVAFGSTWWMTETGGIVISHAPGLYLVPMK 450
           DLS+L+ +   GEP++     W   ++G  K+     +W TETG  ++S   G+    +K
Sbjct: 354 DLSSLKHLFLAGEPLDQPTHEW---IMGELKLPVIDNYWQTETGWPMLSTVRGVEDTKIK 410

Query: 451 PGTNGPPLPGFEVDVVDENGNPAPPGVKGYLVIKKPW-PGMLHGIWGDPERYIKTYWSRF 509
            GT   P+ G++V +  E+G+      KG L +  P  PG L  +WGD ER++ TY+S F
Sbjct: 411 YGTPSFPVYGYDVRIFREDGSECDANEKGILGVVPPLPPGCLTTVWGDDERFVNTYFSLF 470

Query: 510 --PGMFYAGDYAIKDKDGYIWVLGRADEVIKVAGHRLGTYELESALISHPAVAESAVVGV 567
             P ++ + D+AIKD +GY ++LGR D+VI VAGHRLGT E+E A+  HPAVAE AVVGV
Sbjct: 471 KEPLVYSSYDWAIKDDEGYHFILGRTDDVINVAGHRLGTREIEEAVQGHPAVAEVAVVGV 530

Query: 568 PDAIKGEVPIAFVVLKQG--VAPSD---ELRKELREHVRRTIGPIAEPAQIFFVTKLPKT 622
            DA+KG++P+AF V+K    +A  +    L KE+ + V  T+G IA P +++F++ LPKT
Sbjct: 531 NDALKGQLPVAFAVVKDASKIATPELVAALEKEVMKRVDETLGAIARPGRVYFISGLPKT 590

Query: 623 RSGKIMRRLLKAVATGAPLGDVTTLEDETSVEEAKRA 659
           RSGK++RR ++A+A G   GD+TT+ED T++E+ K A
Sbjct: 591 RSGKLLRRSIQALAEGRDPGDLTTIEDPTALEQIKAA 627


Lambda     K      H
   0.319    0.138    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1224
Number of extensions: 68
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 670
Length of database: 630
Length adjustment: 38
Effective length of query: 632
Effective length of database: 592
Effective search space:   374144
Effective search space used:   374144
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory