GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Dechlorosoma suillum PS

Align isovalerate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate Dsui_3212 Dsui_3212 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II

Query= metacyc::MONOMER-20124
         (573 letters)



>lcl|FitnessBrowser__PS:Dsui_3212 Dsui_3212 acyl-CoA synthetase
           (AMP-forming)/AMP-acid ligase II
          Length = 555

 Score =  124 bits (310), Expect = 1e-32
 Identities = 144/554 (25%), Positives = 223/554 (40%), Gaps = 64/554 (11%)

Query: 49  ERSSKAYRDNTSLVYGSVRYTWAQTHHRCLKLASALTTHLGISPGDVVATFSYNLPEIYE 108
           E+S   YRD  + +   V  T+ +        A+ L   L +  G  VA    NL +   
Sbjct: 30  EQSCAQYRDRVAYINMGVGITYGELDRLSRDFAAYLQDVLKLPQGARVALMMPNLLQYPV 89

Query: 109 LHFAVPMAGGILCTLNARNDSAMVSTLLAHSEAKLIFVEPQLLETARAALDLLAQKDIKP 168
             F    AG ++   N       +   L  S A+ I +      T   AL L+    +K 
Sbjct: 90  CMFGALRAGYVVVNCNPLYTHRELEHQLKDSGAEAIVIVENFAHTLEQALPLVP--GLKH 147

Query: 169 PTLVLLTDS--------------------ESFTSSSYDHYNHLLANGSDDFEIRRPKNEW 208
             +  L D                      ++    +  +   +A G             
Sbjct: 148 VIVTSLGDMLGALKGTVVNLVVRHVKKMVPAWKLPRHVKFKAAMARGKGATLRPVQVGHE 207

Query: 209 DPISINYTSGTTARPKAVVYSHRGAYLN-----SIATVLLHGMGTTSVYLWSVPMFHC-- 261
           D   + YT GTT   K  +  HR    N     +     LH      + + ++P++H   
Sbjct: 208 DIAYLQYTGGTTGVAKGAMLLHRNIIANLQQAHAWIEPFLHK--DQQLIITALPLYHIFS 265

Query: 262 -NGWCFPWGAAAQGATNICIRKVSPKAI---FDNIHLHKVTHFGAAPTVLNMIVNSPEGN 317
               C  +     GATN+ I   +P+ I      +  +K T      T+ N ++N+P+  
Sbjct: 266 LTANCLTF--LKIGATNVLI--TNPRDIPGFVKELAQYKFTVITGVNTLFNALLNNPD-- 319

Query: 318 LHTPLPHK-VEVMTGGSPPPPKVIARM--EEMGFQVNHIYGLTETCGPAANCVCKPEWDA 374
               L    +    GG     K +A+   +  G  +   YGLTET  PAA          
Sbjct: 320 -FAKLDFSALRAALGGGMAVQKSVAQKWRQVTGKPLIEAYGLTET-SPAAT--------- 368

Query: 375 LQPEERYALKARQGLNHLAMEEMDVRDPVTMESVRADGATIGEVMFRGNTVMSGYFKDLK 434
           + P +        GL  ++  E+ +RD +  +         GE+  RG  VM GY+    
Sbjct: 369 INPLDLGEFNGAIGLP-ISSTEIVIRDDLGNDLPVGQA---GEICIRGPQVMKGYWLRPD 424

Query: 435 ATEEAFEG-GWFRSGDLGVKHEDGYIQLKDRKKDVVISGGENISTVEVETVLYSHEAVLE 493
            T   F   G+ R+GD+GV  E G++++ DRKKD+++  G N+   EVE V+  H AV+E
Sbjct: 425 ETATVFYADGFLRTGDVGVMDEKGFVRIVDRKKDMILVSGFNVYPNEVEAVVAMHPAVME 484

Query: 494 AAVVARPDKLWGETPCAFVTLKEGFDNDVSADQIIKFCRDRLPHYMAPKTVVF-EELPKT 552
            A V  P +  GE    FV LK   D  V+ +Q+I  C++ L  Y  P  V F ++LPKT
Sbjct: 485 VAAVGVPSEHSGEAVKIFVVLK---DKSVTKEQLIAHCKENLTGYKVPHLVEFRDDLPKT 541

Query: 553 STGKIQKYILKEKA 566
           + GKI +  LKE A
Sbjct: 542 NVGKILRRALKEAA 555


Lambda     K      H
   0.318    0.133    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 638
Number of extensions: 28
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 573
Length of database: 555
Length adjustment: 36
Effective length of query: 537
Effective length of database: 519
Effective search space:   278703
Effective search space used:   278703
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory