GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Dechlorosoma suillum PS

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate Dsui_0437 Dsui_0437 succinate-semialdehyde dehydrogenase

Query= BRENDA::P51650
         (523 letters)



>lcl|FitnessBrowser__PS:Dsui_0437 Dsui_0437 succinate-semialdehyde
           dehydrogenase
          Length = 483

 Score =  551 bits (1419), Expect = e-161
 Identities = 276/481 (57%), Positives = 361/481 (75%), Gaps = 7/481 (1%)

Query: 44  ADLLRGDSFVGGRWLPTPATFPVYDPASGAKLGTVADCGVPEARAAVRAAYDAFSSWKEI 103
           ++LLR   ++ G+W+   + FPV++PASGA+L  V   G  E RAA+ AA  A+ +W+  
Sbjct: 6   SNLLRQQCYLNGQWVGGESDFPVHNPASGAELARVPRFGAAETRAAIAAADAAWPAWRSR 65

Query: 104 SVKERSSLLRKWYDLMIQNKDELAKIITAESGKPLKEAQGEILYSAFFLEWFSEEARRVY 163
           + KER+ +LR+W++LM Q+ D+LA ++T+E GKPL EA+GE+ Y+A F+EWF+EEA+R Y
Sbjct: 66  TAKERTGVLRRWFELMNQHADDLALLMTSEQGKPLAEARGEVAYAASFVEWFAEEAKRAY 125

Query: 164 GDIIYTSAKDKRGLVLKQPVGVASIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPY 223
           G+ I   A DKR LV+KQP+GV + ITPWNFP+AMITRKV  ALAAGCTVVVKPAE TP 
Sbjct: 126 GETIPAVAADKRMLVIKQPIGVCAAITPWNFPAAMITRKVAPALAAGCTVVVKPAEQTPL 185

Query: 224 SALALAQLANQAGIPPGVYNVIPCSRTKAKEVGEVLCTDPLVSKISFTGSTATGKILLHH 283
           +ALALA+LA++AG P GV+NVI         +G  L ++P V K+SFTGST  G++L+  
Sbjct: 186 TALALAELAHRAGFPAGVFNVITGDPV---AIGGELTSNPTVRKLSFTGSTEVGRLLMGQ 242

Query: 284 AANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNAGQTCVCSNRFLVQRGIHDS 343
            A S+K++S+ELGG APFIVFD A++D AV GAM SK+RN GQTCVC+NR LVQ GI+++
Sbjct: 243 CAPSIKKLSLELGGNAPFIVFDDADLDAAVEGAMISKYRNTGQTCVCANRLLVQDGIYEA 302

Query: 344 FVTKFAEAMKKSLRVGNGFEEGTTQGPLINEKAVEKVEKHVNDAVAKGATVVTGGKRHQ- 402
           F  + A A   +L+VG G E G TQGPLI+  A+ KVE H+ DAVA GA V+ GG+RH+ 
Sbjct: 303 FAARLA-AKVATLKVGEGTEAGVTQGPLIDADALAKVEAHIADAVAHGARVLAGGRRHER 361

Query: 403 --SGGNFFEPTLLSNVTRDMLCITEETFGPVAPVIKFDKEEEAVAIANAADVGLAGYFYS 460
              GG FF+PT+L++VT  M    EETFGPVAP+ +F  EEEA+A+ANA + GLA YFYS
Sbjct: 362 YREGGAFFQPTVLADVTPQMRVAREETFGPVAPLFRFQTEEEAIALANATEFGLASYFYS 421

Query: 461 QDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEVKYVCY 520
           +D  +I+RV E LE GMVGVN GLIS+   PFGG+KQSGLGREGSKYG++EYLEVKY+C 
Sbjct: 422 RDIGRIFRVGEALEYGMVGVNTGLISNEVAPFGGIKQSGLGREGSKYGLEEYLEVKYLCL 481

Query: 521 G 521
           G
Sbjct: 482 G 482


Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 636
Number of extensions: 20
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 523
Length of database: 483
Length adjustment: 34
Effective length of query: 489
Effective length of database: 449
Effective search space:   219561
Effective search space used:   219561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory