GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Dechlorosoma suillum PS

Align Aldehyde dehydrogenase; Acetaldehyde dehydrogenase; EC 1.2.1.3 (characterized)
to candidate Dsui_1464 Dsui_1464 NAD-dependent aldehyde dehydrogenase

Query= SwissProt::A1B4L2
         (508 letters)



>lcl|FitnessBrowser__PS:Dsui_1464 Dsui_1464 NAD-dependent aldehyde
           dehydrogenase
          Length = 506

 Score =  773 bits (1997), Expect = 0.0
 Identities = 375/492 (76%), Positives = 422/492 (85%)

Query: 17  FEERYDNFIGGEWVAPVSGRYFTNTTPITGAEIGQIARSEAGDIELALDAAHAAKEKWGA 76
           ++ RYDNFIGG+WVAPV G+YF   TPITG    Q A+S A DIELALDAAHAA +KWG 
Sbjct: 15  YKARYDNFIGGKWVAPVKGQYFDVITPITGKPYTQAAQSGAEDIELALDAAHAAADKWGK 74

Query: 77  TSPAERANIMLKIADRMERNLELLATAETWDNGKPIRETMAADLPLAIDHFRYFAGVLRA 136
           TS  ER+NI+LKIADR+E NLE+LA  ET DNGK IRET+ AD+PLA DHFRYFAG LR+
Sbjct: 75  TSATERSNILLKIADRIEANLEMLAYVETVDNGKAIRETLNADIPLAADHFRYFAGCLRS 134

Query: 137 QEGSISQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPAIAAGNCVVLKPAEQTP 196
           QEGSIS+ID++T+AYHFHEPLGVVGQIIPWNFP+LMA WKLAPA+ AGNCVVLKPAE TP
Sbjct: 135 QEGSISEIDENTIAYHFHEPLGVVGQIIPWNFPILMAAWKLAPALGAGNCVVLKPAESTP 194

Query: 197 AGIMVWANLIGDLLPPGVLNIVNGFGLEAGKPLASSNRIAKIAFTGETTTGRLIMQYASE 256
             I+V A LI DLLPPGVLNIVNG+G +AG  LASS RIAKIAFTG T TGR+I Q A+ 
Sbjct: 195 ISILVLAELIADLLPPGVLNIVNGYGRDAGMALASSKRIAKIAFTGSTATGRVIAQAAAN 254

Query: 257 NLIPVTLELGGKSPNIFFADVAREDDDFFDKALEGFTMFALNQGEVCTCPSRVLIQESIY 316
           +LIP TLELGGKSPNIFFADVA  DDDFFDKA+EG  +FA NQGEVCTCPSR LI ESIY
Sbjct: 255 SLIPATLELGGKSPNIFFADVAAADDDFFDKAIEGLVLFAFNQGEVCTCPSRALIHESIY 314

Query: 317 DKFMERAVQRVQAIKQGDPRESDTMIGAQASSEQKEKILSYLDIGKKEGAEVLTGGKAAD 376
           D FMER + RV+AIKQG P ++D+M+GAQAS  Q +KI+SYL IGK+EGA+ L GG  A 
Sbjct: 315 DHFMERVLARVKAIKQGSPLDTDSMMGAQASQMQMDKIMSYLAIGKEEGAQCLVGGDRAR 374

Query: 377 LGGELSGGYYIEPTIFRGNNKMRIFQEEIFGPVVSVTTFKDQAEALEIANDTLYGLGAGV 436
           LGGEL+ GYYI+PT+F+G+NKMRIFQEEIFGPV++VTTFK +AEALEIANDT YGLGAGV
Sbjct: 375 LGGELAEGYYIQPTLFKGHNKMRIFQEEIFGPVLAVTTFKTEAEALEIANDTPYGLGAGV 434

Query: 437 WSRDANTCYRMGRGIKAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLDHYQQTKNM 496
           WSRD NT YRMGRGIKAGRVWTNCYHAYPAHA FGGYK+SGIGRETHKMMLDHYQQTKN+
Sbjct: 435 WSRDGNTAYRMGRGIKAGRVWTNCYHAYPAHATFGGYKESGIGRETHKMMLDHYQQTKNL 494

Query: 497 LVSYSPKKLGFF 508
           LVSYSPK LGFF
Sbjct: 495 LVSYSPKALGFF 506


Lambda     K      H
   0.319    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 859
Number of extensions: 27
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 508
Length of database: 506
Length adjustment: 34
Effective length of query: 474
Effective length of database: 472
Effective search space:   223728
Effective search space used:   223728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory