Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate Dsui_3212 Dsui_3212 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II
Query= reanno::acidovorax_3H11:Ac3H11_3009 (578 letters) >FitnessBrowser__PS:Dsui_3212 Length = 555 Score = 213 bits (543), Expect = 1e-59 Identities = 165/542 (30%), Positives = 256/542 (47%), Gaps = 17/542 (3%) Query: 29 QTIGAFFADMVARQPEREALVSVHQGRRYTYAQLQTEAHRLASALLG-MGLTPGDRVGIW 87 +++G F A+ +R A +++ G TY +L + A+ L + L G RV + Sbjct: 23 KSLGQLFEQSCAQYRDRVAYINMGVG--ITYGELDRLSRDFAAYLQDVLKLPQGARVALM 80 Query: 88 SHNNAEWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSMARFKTS--DYLG 145 N ++ + + G V+VN NP Y E+E+ L G + +V + F + L Sbjct: 81 MPNLLQYPVCMFGALRAGYVVVNCNPLYTHRELEHQLKDSGAEAIVIVENFAHTLEQALP 140 Query: 146 MLRELAPEWQGQQPGHLQAAKLPQLKTVVWIDDEAGQGADEPGLLRFTELIARGNAADPR 205 ++ L L A K + VV + P ++F +ARG A R Sbjct: 141 LVPGLKHVIVTSLGDMLGALKGTVVNLVVRHVKKMVPAWKLPRHVKFKAAMARGKGATLR 200 Query: 206 LAQVAAGLQATDPINIQFTSGTTGFPKGATLTHRNILNNGFFIGECMK--LTPADRLCIP 263 QV D +Q+T GTTG KGA L HRNI+ N ++ L +L I Sbjct: 201 PVQVGH----EDIAYLQYTGGTTGVAKGAMLLHRNIIANLQQAHAWIEPFLHKDQQLIIT 256 Query: 264 -VPLYHCFGMVLGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELD 322 +PLYH F + L GAT V + D ++ + + T + GV T+F A L+ Sbjct: 257 ALPLYHIFSLTANCLTFLKIGATNVLITNPRDIPGFVKELAQYKFTVITGVNTLFNALLN 316 Query: 323 HPRFAEFNLSTLRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTP 382 +P FA+ + S LR + G V ++ Q+ + + AYG+TETSP + + D Sbjct: 317 NPDFAKLDFSALRAALGGGMAVQKSVAQKW-RQVTGKPLIEAYGLTETSPAATINPLD-- 373 Query: 383 LSKRVSTVGQVQPHLEVKIVDPDTGAVVPIGQRGEFCTKGYSVMHGYWGDEAKTREAIDE 442 L + +G E+ I D D G +P+GQ GE C +G VM GYW +T Sbjct: 374 LGEFNGAIGLPISSTEIVIRD-DLGNDLPVGQAGEICIRGPQVMKGYWLRPDETATVFYA 432 Query: 443 GGWMHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPD 502 G++ TGD+ MD +G+V IV R KDM++ G N+YP E+E + HP V +V VGVP Sbjct: 433 DGFLRTGDVGVMDEKGFVRIVDRKKDMILVSGFNVYPNEVEAVVAMHPAVMEVAAVGVPS 492 Query: 503 QKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKI 562 + GE + +++ K T++ + A CK + YKVP + F P T GKI + + Sbjct: 493 EHSGEAVKIFVVLK-DKSVTKEQLIAHCKENLTGYKVPHLVEFRDDLPKTNVGKILRRAL 551 Query: 563 RD 564 ++ Sbjct: 552 KE 553 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 715 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 578 Length of database: 555 Length adjustment: 36 Effective length of query: 542 Effective length of database: 519 Effective search space: 281298 Effective search space used: 281298 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory