Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate Dsui_2312 Dsui_2312 3-hydroxybutyrate dehydrogenase
Query= metacyc::MONOMER-20835 (262 letters) >FitnessBrowser__PS:Dsui_2312 Length = 260 Score = 137 bits (345), Expect = 2e-37 Identities = 86/253 (33%), Positives = 137/253 (54%), Gaps = 8/253 (3%) Query: 12 GLRVLISGGAAGIGEVLAAAYLEAGAQVHV-----CDVSESALAVFRDKYPGTVA-TRAD 65 G L++G +GIG +A A GA V + +E A ++ VA T AD Sbjct: 4 GKIALVTGSTSGIGLAVARALARNGAAVMLNGSRPAAEAEGLRAAMAAEFGVKVAYTSAD 63 Query: 66 VSDAAQIEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQYRFA 125 ++DAA + A+ + LG +D+LVNNAGI +D + +W I INL++ + Sbjct: 64 LADAASVRALAAAAEKQLGVVDILVNNAGIQH-VAAVDEFPEEKWDQLIAINLSSVFHAT 122 Query: 126 HHAVPMLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNA 185 +P +K + G +++IAS G + ++ PY A+K A+VG K++A E+ E+ I NA Sbjct: 123 KAVLPGMKARNWGRIVNIASAHGLVASPFKAPYTASKHAVVGFSKAVALEVAETGITCNA 182 Query: 186 LLPGIVEGPRMDGVIRARAEQVGVPEAE-MRQEYLNKISLKRMVTAEDVAAMALFLCSPA 244 + PG V P ++ + A+A+ +PE + +R L KR + A+D+A LFLCSPA Sbjct: 183 VCPGYVRTPLVEKQVAAQAKVHNLPEDQVIRDVILAAQPNKRFLEADDLAEFVLFLCSPA 242 Query: 245 ARNVTGQAISVDG 257 +TG A+ +DG Sbjct: 243 GAGMTGAALPMDG 255 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 260 Length adjustment: 25 Effective length of query: 237 Effective length of database: 235 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory