Align alcohol dehydrogenase (EC 1.1.1.1); long-chain-alcohol dehydrogenase (EC 1.1.1.192) (characterized)
to candidate Dsui_2116 Dsui_2116 Fe-dependent oxidoreductase, alcohol dehydrogenase
Query= BRENDA::A4ISB9 (387 letters) >FitnessBrowser__PS:Dsui_2116 Length = 382 Score = 279 bits (714), Expect = 8e-80 Identities = 155/390 (39%), Positives = 227/390 (58%), Gaps = 11/390 (2%) Query: 1 MQNFTFRNPTKLIFGRGQIEQLKEEVPKYG-KKVLLVYGGGSIKRNGLYDEVMSLLTDIG 59 M NFTF NPT++ FG+ + + + + ++G KKVLL YG IKR+GL+ V L + G Sbjct: 1 MDNFTFFNPTQVEFGKDKEQAIGRHLAEHGIKKVLLCYGSERIKRDGLFGVVSKSLAEQG 60 Query: 60 AEVVELPGVEPNPRLSTVKKGVDICRREGIEFLLAVGGGSVIDCTKAIAAGAKFDGDPWE 119 VE G+ NP +S V++ + + R +E +L+VGGGSV+D +KAIAAG + GD W+ Sbjct: 61 ITFVECGGIVSNPVISKVREAIALARDHQVEAILSVGGGSVLDSSKAIAAGVPYAGDVWD 120 Query: 120 FITKKATVTEALPFGTVLTLAATGSEMNAGSVITNWETKEKYGWGSPVTFPQFSILDPTY 179 K + ALP +LTLAATGSEMN G+V+TN T+EK+ S T+P+ SI++P Sbjct: 121 LFIGKGRIESALPVFDILTLAATGSEMNNGAVVTNEATQEKFAITSVHTYPKVSIVNPAL 180 Query: 180 TMTVPKDHTVYGIVDMMSHVFEQYFHHTPNTPLQDRMCEAVLKTVIEAAPKLVDDLENYE 239 TV +D+ VY D+++H E YF Q R+ EA++ TVIE L+ D ENYE Sbjct: 181 MKTVSRDYLVYSAADVIAHAIEGYFTAKDEPRFQSRLVEAIINTVIETTETLLADPENYE 240 Query: 240 LRETIMYSGTIALNGFLQMGVRG-DWATHDIEHAVSAVYDIPHAGGLAILFPNWMKHVLD 298 R ++ T ALNG L G+ G + H IEH++SA++++PH GL+++ P WMK Sbjct: 241 ARAEFAWAATQALNGLLYAGISGYSYPNHMIEHSLSALFNVPHGAGLSVVMPAWMKWYHS 300 Query: 299 ENVSRFAQLAVRVFDVDPTGKTERDVALEGIERLRAFWSSLGAPSRLADYGIGEENLELM 358 N +F + A VF V + A +GI L ++ +G P+RL+ GI E +L Sbjct: 301 RNPVQFQRFAKYVFGV--------ETAEQGIAALEKWFDKIGTPTRLSQLGISEADLPKT 352 Query: 359 ADKAMAFG-EFGRFKTLNRDDVLAILRASL 387 D + FG +T RD V IL+++L Sbjct: 353 IDNVLGNAVHFGVAETYPRDVVATILKSAL 382 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 382 Length adjustment: 30 Effective length of query: 357 Effective length of database: 352 Effective search space: 125664 Effective search space used: 125664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory