Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate Dsui_2448 Dsui_2448 3-oxoacyl-(acyl-carrier-protein) reductase
Query= BRENDA::A0A075B5H4 (258 letters) >FitnessBrowser__PS:Dsui_2448 Length = 246 Score = 123 bits (309), Expect = 3e-33 Identities = 88/252 (34%), Positives = 133/252 (52%), Gaps = 13/252 (5%) Query: 5 LKGKRILITGSTEGIGMATAIELARYGA-VVGLNSHVDPADPALLLGKLREAGGDGAFFR 63 L+G+ L+TG++ GIG A A+ELAR GA VVG + D A + L EAG G Sbjct: 2 LQGQIALVTGASRGIGKAVALELARLGATVVGTATSDDGAGK--ISAYLAEAGAKGRGAL 59 Query: 64 ADITKTAECQRLVSAFVERFDGIDVLINNAGGLAGRSNLE-NIDDAFYDRVMDLNGRSVL 122 ++ A+ L++A + F + +L+NNAG R NL + D +D V+D N ++V Sbjct: 60 LEVRDQAQVDALIAALEKEFGAVSILVNNAG--ITRDNLAMRMKDDEWDAVIDTNLKAVF 117 Query: 123 MMTKFAIPHLRASAKASGTTSAVISTGSIAAREGGGIGAGVYAASKAWLHDIHRNWVKEF 182 ++K +R KA +I+ S+ G G Y A+KA + + R+ +E Sbjct: 118 RLSKAV---MRGMMKARA--GRIINITSVVGHAGNP-GQANYCAAKAGVSGMTRSLAREL 171 Query: 183 TKDSIRFNIVAPGTVDTAFHADKSDELKTRIANSIPMGRFGTVQELAPAYVFFASHAASG 242 +I N VAPG +DT D+ K + +IP+GR G+ +++A A F AS AA G Sbjct: 172 GSRNITVNCVAPGFIDTDMTKALDDKQKEGLLGNIPLGRLGSPEDIAAAVAFLASPAA-G 230 Query: 243 YITGQILDVNGG 254 Y+TG + VNGG Sbjct: 231 YVTGSTIHVNGG 242 Lambda K H 0.320 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 246 Length adjustment: 24 Effective length of query: 234 Effective length of database: 222 Effective search space: 51948 Effective search space used: 51948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory