Align L-fuculose-phosphate aldolase (EC 4.1.2.17) (characterized)
to candidate Dsui_3380 Dsui_3380 ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Query= BRENDA::P0AB87 (215 letters) >FitnessBrowser__PS:Dsui_3380 Length = 216 Score = 162 bits (409), Expect = 6e-45 Identities = 87/208 (41%), Positives = 126/208 (60%), Gaps = 6/208 (2%) Query: 8 RQIIDTCLEMTRLGLNQGTAGNVSVRYQ----DGMLITPTGIPYEKLTESHIVFID-GNG 62 + +I M GLN+GTAGN+S+R + DG +TPTG+ Y+ L I F+ +G Sbjct: 7 QSLITAAHRMAAEGLNRGTAGNLSLRAKLDGVDGFYVTPTGMNYDSLQAEDIPFVKLADG 66 Query: 63 KHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGGNS 122 H +LPSSEWRFH Y +RP+ AV+H H+ T+++ L R IP HYMIA GG++ Sbjct: 67 SHVGRRLPSSEWRFHRDIYAARPETGAVLHAHSPFATSLACLRRDIPPFHYMIARFGGDT 126 Query: 123 IPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQLYL 182 + C+ YATFGT+ LS+ AL+ RK LL +HG+I C +L +AL L E+E L++ + Sbjct: 127 VRCSDYATFGTQALSDTALAALEERKGCLLANHGMIVCGKDLGEALALGVELESLSEQFW 186 Query: 183 TTLAITDPVPVLSDEEIAVVLEKFKTYG 210 + V +L E++A L +F TYG Sbjct: 187 RASQLGSAV-LLDTEQMAEALARFATYG 213 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 216 Length adjustment: 22 Effective length of query: 193 Effective length of database: 194 Effective search space: 37442 Effective search space used: 37442 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory