Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate Dsui_2312 Dsui_2312 3-hydroxybutyrate dehydrogenase
Query= uniprot:B2T9V3 (247 letters) >FitnessBrowser__PS:Dsui_2312 Length = 260 Score = 149 bits (377), Expect = 4e-41 Identities = 92/258 (35%), Positives = 140/258 (54%), Gaps = 17/258 (6%) Query: 5 LAGKTALITAAGQGIGLATAELFAREGARVIATDIR----IDGLA-------GKPVEARK 53 L+GK AL+T + GIGLA A AR GA V+ R +GL G V Sbjct: 2 LSGKIALVTGSTSGIGLAVARALARNGAAVMLNGSRPAAEAEGLRAAMAAEFGVKVAYTS 61 Query: 54 LDVRDDAAIKALAA----EIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRM 109 D+ D A+++ALAA ++G VD+L N AG H + E EE WD +N+ +++ Sbjct: 62 ADLADAASVRALAAAAEKQLGVVDILVNNAGIQHVAAVDEFPEEKWDQLIAINLSSVFHA 121 Query: 110 IRAFLPAMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRC 169 +A LP M + G I+N++SA V P + Y+ASK AV+G +K+VA + G+ C Sbjct: 122 TKAVLPGMKARNWGRIVNIASAHGLVAS-PFKAPYTASKHAVVGFSKAVALEVAETGITC 180 Query: 170 NAICPGTVASPSLEQRIVAQAQAQGATLD-AVQAAFVARQPMGRIGKPEEIAALALYLGS 228 NA+CPG V +P +E+++ AQA+ D ++ +A QP R + +++A L+L S Sbjct: 181 NAVCPGYVRTPLVEKQVAAQAKVHNLPEDQVIRDVILAAQPNKRFLEADDLAEFVLFLCS 240 Query: 229 DESSFTTGHAHVIDGGWS 246 + TG A +DG W+ Sbjct: 241 PAGAGMTGAALPMDGAWT 258 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 260 Length adjustment: 24 Effective length of query: 223 Effective length of database: 236 Effective search space: 52628 Effective search space used: 52628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory