Align TRAP-type large permease component (characterized, see rationale)
to candidate Dsui_2534 Dsui_2534 TRAP transporter, DctM subunit
Query= uniprot:Q930R2 (425 letters) >FitnessBrowser__PS:Dsui_2534 Length = 429 Score = 271 bits (693), Expect = 3e-77 Identities = 152/424 (35%), Positives = 241/424 (56%), Gaps = 5/424 (1%) Query: 5 VFIVSLLGAMAIGVPVAFSLMFCGVVLMWYMGMFNTQIIAQNMIAGADTFTLLAIPFFIL 64 + +S M +GVP+ ++ G+ ++++ G + ++ G + LLAIP F+L Sbjct: 4 LLFLSFFALMLLGVPLGTAMGLAGLAVVFF-GDLGLMSLPTSVYTGIAKYPLLAIPVFVL 62 Query: 65 AGELMNAGGLSRRIIDFAIACVGHIRGGLGIVAIMAAVIMASISGSAAADTAALAAILIP 124 AG + G++ R++ FA+A VG RGGL + AI+ +++ ISGS AD AA+A ++IP Sbjct: 63 AGMIFERSGVALRLVRFAVALVGQRRGGLALAAILVCMVLGGISGSGPADAAAVATVMIP 122 Query: 125 MMAKAGYNVPRSAGLIAAGGVIAPVIPPSMAFIVFGVAA-NVSITQLFMAGIVPGLIMGI 183 MA+AGY SA +IAA G A +IPPS+ FI++ V S+ LF AG++PGL+ G+ Sbjct: 123 SMARAGYPAAFSASVIAAAGSTAILIPPSIVFILYSVLVPQASVPALFAAGLIPGLLAGL 182 Query: 184 ALV--ATWLLVVRKDDIQPLPRTPMKERV-GATGRALWALGMPVIILGGIKAGVVTPTEA 240 AL+ A WL V + L ++ A A W L PVIILGG+++G TPTEA Sbjct: 183 ALMLPAWWLSVRHGFGVAGLQDGEARQSFWSALKEASWGLLAPVIILGGMRSGAFTPTEA 242 Query: 241 AVVAAVYALFVGMVIYRELKPRDLPGVILQAAKTTAVIMFLVCAALVSSWLITAANIPSE 300 AVVA Y LFVG+VIYR L +++ V++++A+ +AV+M ++ A V +W + Sbjct: 243 AVVAVFYGLFVGLVIYRTLNWKNIYEVLVESAEVSAVVMLIIALASVFAWAGSTLGTFEA 302 Query: 301 ITGFISPLIDRPTLLMFVIMLVVLVVGTALDLTPTILILTPVLMPIIKQAGIDPVYFGVL 360 + G++ L T ++ + L++L+ G LD + I P L+P+I G DPV+FGV+ Sbjct: 303 LGGWLVGLSGNETAILLAVTLLLLIAGMFLDAVSILFIFMPFLLPVILHFGWDPVWFGVI 362 Query: 361 FIMNTCIGLLTPPVGVVLNVVSGVGRVPLGKVIVGVTPFLVAQILVLFLLVLFPDIVIVP 420 MN IG TPP+ + L V S + + + + V + A + L L+ P++ Sbjct: 363 LTMNVAIGQFTPPMAINLMVTSRIAGIRIEDTVPWVLWMVGAMLSALLLVTFVPELATGI 422 Query: 421 ARWL 424 R+L Sbjct: 423 PRYL 426 Lambda K H 0.331 0.145 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 502 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 429 Length adjustment: 32 Effective length of query: 393 Effective length of database: 397 Effective search space: 156021 Effective search space used: 156021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory