Align TRAP dicarboxylate transport system, periplasmic component (DctP-like) (characterized, see rationale)
to candidate Dsui_3155 Dsui_3155 tripartite ATP-independent periplasmic transporter solute receptor, DctP family
Query= uniprot:G8AR24 (337 letters) >FitnessBrowser__PS:Dsui_3155 Length = 332 Score = 183 bits (464), Expect = 6e-51 Identities = 107/325 (32%), Positives = 183/325 (56%), Gaps = 6/325 (1%) Query: 9 LATGLAAAILAPVAASAQDIKPRLIRFGYGLSESSNQGRAVKFFVEDMAKRSGGKLKVKG 68 L GL A +L+ A + Q P +I+F + ++ + +G A FF + A+ + GK+KV+ Sbjct: 6 LMFGLLAGVLSCGAMAQQ---PIVIKFSHVVAVDTPKGMAADFFAKKAAELTKGKVKVEV 62 Query: 69 FADASLGSDIQMQNALIGGAQEMMVGSTATLVGI-VKDFAVFDLPFLFNNEQEADAVFDG 127 + ++ L D + AL GA +M+ S A + V++F FDLP++F+N +E V G Sbjct: 63 YPNSQLYKDKEEMEALQLGAVQMLAPSLAKFGPLGVREFEAFDLPYIFDNYEELHKVTTG 122 Query: 128 PFGQKLAAKLNDKGLVGLVYWENGFRNLTNSKRPVEKVEDLKGIKLRVMQNPVYIDMFNG 187 P G L AKL KG+ GL YW+NGF++ + + P++ DLKG K+R+ + V + Sbjct: 123 PVGAALLAKLEPKGIKGLAYWDNGFKSFS-ANTPIKTPADLKGKKMRIQSSKVLEEEMRS 181 Query: 188 FGANAVPLSFSELFTAMETGTVDGQENPVTTIQSSKFYEVQKYLTISKHVYSPWIVLASK 247 GA ++FSE++ A++TG VDG ENP++ + + K +EVQK+LT++ H Y + V+ +K Sbjct: 182 LGALPQVMAFSEVYQALQTGVVDGTENPISNLYTQKMHEVQKHLTLTDHGYLGYAVIVNK 241 Query: 248 RWYDGLSADERKIINEAAVASRDFERKDSREASKQSIAYLKDKG-MQINELSDAELGRMR 306 +++DGL AD R + A + + K ++E + + + +K G Q+ + E + Sbjct: 242 KFWDGLPADVRGQLETAMKDATTYANKIAKEQNDKDLESVKKSGKTQVYVPTKEEREAFK 301 Query: 307 EMVKPAMDKFAADGGADLLNELQGE 331 + + P K A G DL+ + E Sbjct: 302 KALTPVHAKMADRIGKDLIQSIYKE 326 Lambda K H 0.317 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 332 Length adjustment: 28 Effective length of query: 309 Effective length of database: 304 Effective search space: 93936 Effective search space used: 93936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory