Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate Dsui_1101 Dsui_1101 glucosamine--fructose-6-phosphate aminotransferase, isomerizing
Query= reanno::Caulo:CCNA_00453 (363 letters) >FitnessBrowser__PS:Dsui_1101 Length = 608 Score = 135 bits (340), Expect = 3e-36 Identities = 102/311 (32%), Positives = 154/311 (49%), Gaps = 19/311 (6%) Query: 66 VVTCARGSSDHAATFARYLIETKAGVLTSSAGPSVSSVYDASPNLEGALYLAISQSGKSP 125 V+ A G+S HA ARY +E AG+ + S ++ P + L +AISQSG++ Sbjct: 294 VLILACGTSSHAGMAARYWLEAVAGIPCTVETASEYRYRESVPQAD-QLVIAISQSGETA 352 Query: 126 DLLAAVKAAKAAGAH-AVALVNVVDSPLAALADEVIPLHAGPELSVAATKSY---IAALV 181 D LAA++ AKA G H +AL NV +S + AGPE+ VA+TK++ +AAL Sbjct: 353 DTLAALRHAKALGHHRTLALCNVPESAIVRECALRFITRAGPEIGVASTKAFTTQLAALF 412 Query: 182 AVTQLIAAW------TEDAELTAALQDLPTALAAAWTLDWSLAV--ERLKTASNLYVLGR 233 +T ++A TE+A AL+ LP A+ A L+ + ER + LGR Sbjct: 413 LLTLVLAKLKGRLSDTEEAIQLQALRHLPAAIGRALELEPQIKAWAERFAMKQHALFLGR 472 Query: 234 GVGFGVALEAALKFKETCGLHAEAFSAAEVLHGPMALVKDGFPALVFAQNDESRASVDEM 293 G+ + +ALE ALK KE +HAEA+ A E+ HGP+ALV P + A ND + Sbjct: 473 GIHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVDKDMPVIAVAPNDVLLEKLKSN 532 Query: 294 AAGLRARGASVLIAGGG------GDAPDALPTLASHPVLEPILMIQSFYRMANALSVARG 347 ++ARG + + + L + L PIL + ++ ++ +G Sbjct: 533 LQEVKARGGELYVFADADSEIAESEGVHILRLPEHYGRLSPILHVIPLQLLSYHAALVKG 592 Query: 348 YDPDSPPHLNK 358 D D P +L K Sbjct: 593 TDVDKPRNLAK 603 Lambda K H 0.315 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 608 Length adjustment: 33 Effective length of query: 330 Effective length of database: 575 Effective search space: 189750 Effective search space used: 189750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory