Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate Dsui_2943 Dsui_2943 ABC-type spermidine/putrescine transport system, ATPase component
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >FitnessBrowser__PS:Dsui_2943 Length = 356 Score = 139 bits (349), Expect = 2e-37 Identities = 108/355 (30%), Positives = 166/355 (46%), Gaps = 22/355 (6%) Query: 3 LALDSISKKVGAQTWLYDMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTVD 62 L L + ++ GA T + + +++G + LLG + GKT+L+R +AG + AG + +D Sbjct: 4 LELADVMQRYGAHTVVDGIGFHIEAGVIACLLGPSGCGKTTLLRCIAGFEDIAAGSIALD 63 Query: 63 GKDVTG----MPVRDRNVAMVYQQFINYPSMKVAANIASPLKLRGEKNIDARVREIASRL 118 G+ V+ + R + MV+Q + +P + VA NIA LK +G + RV + + Sbjct: 64 GELVSRPGFKLAPEQRRIGMVFQDYALFPHLTVADNIAFGLKTKGGER-QQRVAAMLDLV 122 Query: 119 HIDMFLDRYPAELSGGQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFA 178 + ++YP ELSGGQQQRVALARALA L+LLDEP NLD LRE L E+ ++ Sbjct: 123 GLAGQGEKYPHELSGGQQQRVALARALAPAPRLVLLDEPFSNLDVDLRERLSLEVREILK 182 Query: 179 AGQSTVVYATTEPGEALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNL 238 +T + T + EA + V+ EG++ Q+ ++H P + VA + Sbjct: 183 KAGTTAILVTHDQHEAFAMADEIGVMHEGRIQQWDTPYNLYHQPANRFVADFVG---QGV 239 Query: 239 MAASATAQGVRLQ---GGAELTLPLPQGAATAAGLTVGVRASALRVHARPGDV------S 289 G R+Q G E +P+ +AG V + + + RP DV Sbjct: 240 FVPGTVLAGNRVQMELGILESGVPV----ECSAGCGVCGKGCGVDILLRPDDVVHDDKSP 295 Query: 290 VAGVVELAEISGSDTFVHASTPWGDLVAQLTGVHY-FELGTAITLHLDPAQAYVF 343 + VE G+D G V L H+ LG I + LD F Sbjct: 296 LQAAVEHKAFRGADILYTLRLESGARVLSLVPSHHNHALGEKIGIRLDVDHVVAF 350 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 356 Length adjustment: 29 Effective length of query: 334 Effective length of database: 327 Effective search space: 109218 Effective search space used: 109218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory