Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate Dsui_2068 Dsui_2068 ABC-type metal ion transport system, ATPase component
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__PS:Dsui_2068 Length = 278 Score = 240 bits (613), Expect = 3e-68 Identities = 125/227 (55%), Positives = 165/227 (72%), Gaps = 1/227 (0%) Query: 7 VHKTYRVAGREIPALQPTRLNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEG 66 V K++R + + PT L++ G+I G+IG SGAGKSTLLRL N LE P G+++V G Sbjct: 16 VSKSFRTPDGQQVGVHPTDLDVAPGEIHGIIGFSGAGKSTLLRLANLLERPDAGQVVVHG 75 Query: 67 EDVTALDAEGLRRFRQRVGMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELL 126 +D+ L LR RQR+GMIFQHFNLL ++TVADN+A PLR+AG A ++ RV L Sbjct: 76 QDLMTLSPADLRTARQRIGMIFQHFNLLHNRTVADNVAFPLRIAGA-DEARINERVKTCL 134 Query: 127 ARVGLSDHARKYPAQLSGGQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAE 186 VGLS+ A YPAQLSGGQKQRV IARALA P +LL DE TSALDP+TT S+L++LA+ Sbjct: 135 EFVGLSEKAGVYPAQLSGGQKQRVAIARALAPEPHVLLADEPTSALDPRTTQSLLEVLAD 194 Query: 187 INRELKLTIVLITHEMDVIRRVCDQVAVMDGGAIVEQGDVADVFLHP 233 +NR L +TI+L++HEM VIRR+C +V+VM+ G IVE+ +A+ + P Sbjct: 195 VNRRLGVTILLVSHEMGVIRRLCHRVSVMEAGQIVERLTIANGRIPP 241 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 278 Length adjustment: 27 Effective length of query: 308 Effective length of database: 251 Effective search space: 77308 Effective search space used: 77308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory