Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate Dsui_1462 Dsui_1462 ABC-type antimicrobial peptide transport system, ATPase component
Query= TCDB::P73721 (252 letters) >FitnessBrowser__PS:Dsui_1462 Length = 267 Score = 140 bits (352), Expect = 3e-38 Identities = 87/226 (38%), Positives = 135/226 (59%), Gaps = 10/226 (4%) Query: 3 SPTAPLISFDQLQKNFGALQ----VLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLE 58 +P APLI D L K++ Q VL ++ I + ++++GPSG GKST L + ++ Sbjct: 35 TPAAPLIVLDNLSKSYRRGQQVVPVLERISFNIAAGEFLALMGPSGSGKSTLLNLIAGID 94 Query: 59 PISGGRLEVAGVDLSGAKIDQKHLRQLRVR-VGMVFQHFNLFPHLTVLQNLLLAPRKVLR 117 G L VAG D+ A +++ L R VG +FQ +NL P LT L+N+ L P + Sbjct: 95 RPDSGTLSVAGQDI--AALEEAELAAWRAENVGFIFQFYNLMPVLTALENVEL-PLLLKN 151 Query: 118 IPMAEAKDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSAL 177 + AE ++RA L VGL + D+ P++LSGGQ+QRVAIAR L P +++ DEPT L Sbjct: 152 LGKAERRERAELALSMVGLADRMDHTPNELSGGQQQRVAIARALITDPTLIVADEPTGDL 211 Query: 178 DPELVGEVLNVMKQLAEE-GMTMAVVTHEMQFAREVSNRVFFFNQG 222 D E G++L+++++L +E G T+ +VTH+ Q A E ++ + +G Sbjct: 212 DRESAGDILHLLQRLNDELGKTIVMVTHD-QRAAESAHAIMHLEKG 256 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 267 Length adjustment: 24 Effective length of query: 228 Effective length of database: 243 Effective search space: 55404 Effective search space used: 55404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory