Align BraC, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC (characterized)
to candidate Dsui_0630 Dsui_0630 ABC-type branched-chain amino acid transport system, periplasmic component
Query= TCDB::Q9L3M3 (381 letters) >FitnessBrowser__PS:Dsui_0630 Length = 434 Score = 189 bits (479), Expect = 2e-52 Identities = 127/345 (36%), Positives = 171/345 (49%), Gaps = 16/345 (4%) Query: 25 VLIAVAGPLTGPNAAFGAQLQKGAEQAAADINAAG-GINGEQIKIEL--GDDVSDPKQGI 81 V I A PLTGP A G + GA A ++NA G I G ++K EL DD +DPKQG Sbjct: 46 VKIGHASPLTGPQAHIGKDNEYGATLAIEELNAKGLEIGGAKVKFELISDDDQADPKQGT 105 Query: 82 SVANKFAADGVKFVIGHFNSGVSIPASEVYAENGILRNHPGRDEPDLHGTGLWNTFRTCG 141 +VA KF V VIGH NSG +IPAS++Y + GI + P G FR Sbjct: 106 TVAQKFVDAKVNGVIGHLNSGTTIPASKIYFDAGIPQISGSATNPTYTKQGFATAFRVMA 165 Query: 142 RDDQQGAIAGKYLADHFKDAKIAVVHDKTPYGQGLADETKKAMNAAGVTEVIYEGINVGD 201 D+QQG ++ A +A++ D+T YGQGLADE KKA AAG+ V E N Sbjct: 166 NDEQQGKALAQFAAKTLAAKSVAIIDDRTAYGQGLADEFKKAAEAAGLKVVASEYTNDKA 225 Query: 202 KDFSALIAKMKEAGVSIIYWGGLHTEAGLIIRQAADQGLKATLVSGDGIVSNELASIAGD 261 DF A++ K+K +I++GG+ + G + +Q + GLKA ++GDG + ++AG Sbjct: 226 TDFKAILTKIKSKKPDLIFYGGMDPQGGPMAKQMKELGLKAKFLTGDGGCTPNFITLAGA 285 Query: 262 AVAGTLNT-----FGPDPTANPANKELVEKFKAAGFNPEAYTLYSYAAMQTIAGAAKAAG 316 A G + P + V KFK + Y Y Y A + A K A Sbjct: 286 AAEGQYCSLPGVPLDKMPGGTVFKDKFVGKFKT---EIQLYAPYVYDATMVLVDAMKRAN 342 Query: 317 SLDPEAVAKAMKE--KGPFPTVLGDISFDEKGDPKIPGYIMYEWK 359 S++P AK + E K F V I FDE GD K YE+K Sbjct: 343 SVEP---AKYLPEIGKTSFQGVTAKIGFDEFGDLKDGAISFYEYK 384 Lambda K H 0.314 0.132 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 453 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 434 Length adjustment: 31 Effective length of query: 350 Effective length of database: 403 Effective search space: 141050 Effective search space used: 141050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory