Align Enoyl-CoA-hydratase; EC 4.2.1.17 (characterized)
to candidate Dsui_2041 Dsui_2041 enoyl-CoA hydratase/carnithine racemase
Query= SwissProt::G4V4T7 (265 letters) >FitnessBrowser__PS:Dsui_2041 Length = 261 Score = 136 bits (342), Expect = 5e-37 Identities = 97/262 (37%), Positives = 133/262 (50%), Gaps = 9/262 (3%) Query: 3 ETRVRYEKKDHVAYVTMDRPAVLNAMDRRMHEELAGIWDDVEADDDVRAVVLTGAGDRAF 62 E V + KD +A +T++RPA NA+ R M L +D + AD + V+L G G AF Sbjct: 4 EALVLRQDKDGIARLTLNRPAARNALSRPMIAALQAEFDRIAADPSIGVVILAGNGP-AF 62 Query: 63 SVGQDLKE-RARLNESGVAPTTFGSGGQAGHPRLTDRF-TLSKPVVARVRGYALGGGFEL 120 G DLKE R A F + RL R +L +PV+ARV G A G +L Sbjct: 63 CAGHDLKEMRGADYGERYAEDLFEACA-----RLMQRIVSLPQPVIARVHGIATAAGAQL 117 Query: 121 VLACDIVIAAEDAVFALPEVRLGLIAGAGGVFRLPRQLPQKVAMGYLLTGRRMDAATALR 180 V + D+ IA +DA FA P V +GL V L R + K A+ LLTG +DA TALR Sbjct: 118 VASADLAIATDDARFATPGVNIGLFCSTPMV-ALSRNISHKHALQMLLTGDLIDAPTALR 176 Query: 181 HGLVNEVVPAAELDQCVADWTDSLVRAAPLSVRAIKEAALRSVDLPLEEAFTTSYHWEER 240 GL+NE V +LD V + + ++ K A R +LPL+EA+ + Sbjct: 177 FGLINEHVSGEQLDVAVEALAVKIASKSRHTLAVGKAAYYRQAELPLDEAYAYAKGVMVH 236 Query: 241 RRRSADAIEGVRAFAEKRDPIW 262 ++ DA EG+ AF +KR P W Sbjct: 237 NLQARDAREGIDAFIDKRHPTW 258 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 261 Length adjustment: 25 Effective length of query: 240 Effective length of database: 236 Effective search space: 56640 Effective search space used: 56640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory