Align NatD, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate Dsui_0629 Dsui_0629 branched-chain amino acid ABC-type transport system, permease component
Query= TCDB::Q8YXD0 (288 letters) >FitnessBrowser__PS:Dsui_0629 Length = 307 Score = 143 bits (361), Expect = 4e-39 Identities = 91/301 (30%), Positives = 164/301 (54%), Gaps = 21/301 (6%) Query: 1 MDIQTIQLIVNGIAVGSIIALAAVGLTLTYGILRLSNFAHGDFLTLGAYLTFFVNTFGVN 60 MDI +Q I+NG+ +GSI AL A+G T+ YGIL L NFAHG+ + +GA V Sbjct: 1 MDI-FLQQIINGLVLGSIYALVALGYTMVYGILGLINFAHGEVVMIGALTALTVVKLLAG 59 Query: 61 IWL-SMIVAVVGTVGVMLLS-------EKLLWSRMRSIRANSTTLIIISIGLALFLRNGI 112 L ++A++G + + EK+ + +R +A +I +IG+++ L+N Sbjct: 60 SGLPGPVIALIGLMAAAPVCMAIGYGIEKIAYRPLR--KAPRLAPLITAIGVSIVLQNLA 117 Query: 113 ILIWGGRNQNYNLPI-TPALDIFGVKVPQNQLLVLALAVLSIGALHYLLQNTKIGKAMRA 171 +++WG ++ + A ++ G Q++++ +A + L L+ T++G+AMRA Sbjct: 118 MMVWGRSYHSFPAVLPAEAHEVLGATFTDLQVIIVLVAAGMMAGLLLLINRTRLGRAMRA 177 Query: 172 VADDLDLAKVSGIDVEQVIFWTWLIAGTVTSLGGSMYGL-ITAVRPNMGWFLILPLFASV 230 A++ +A++ G++V +I T++I + ++ G M + MG+ L L F + Sbjct: 178 TAENPAIAQLMGVNVNHIISLTFVIGSALAAVAGLMVSANYSIAHYYMGFILGLKAFTAA 237 Query: 231 ILGGIGNPYGAIAAAFIIGIVQ--------EVSTPFLGSQYKQGVALLIMILVLLIRPKG 282 +LGGIGN GA+ ++G+++ +++ FLGS Y+ A ++ILVL+ RP G Sbjct: 238 VLGGIGNLAGAMIGGILLGLIESLGAGYIGDITGGFLGSHYQDVFAFFVLILVLVFRPSG 297 Query: 283 L 283 L Sbjct: 298 L 298 Lambda K H 0.328 0.144 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 307 Length adjustment: 26 Effective length of query: 262 Effective length of database: 281 Effective search space: 73622 Effective search space used: 73622 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory