Align UDP-glucose 4-epimerase; EC 5.1.3.2; Galactowaldenase; UDP-galactose 4-epimerase (uncharacterized)
to candidate Dsui_0398 Dsui_0398 UDP-glucose-4-epimerase
Query= curated2:P55180 (339 letters) >FitnessBrowser__PS:Dsui_0398 Length = 337 Score = 423 bits (1087), Expect = e-123 Identities = 205/332 (61%), Positives = 248/332 (74%) Query: 1 MAILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLL 60 M ILVTGG GYIGSHTCVELL +G+ + +LDNLSNS A+ R+ + G F E D+ Sbjct: 1 MHILVTGGLGYIGSHTCVELLQAGHGVTILDNLSNSRADVAERIAGLGGAAPIFIEGDVR 60 Query: 61 DREAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIV 120 DR+ + +F E ++AVIHFAGLKAVGESVA PL+YY N+ G+ +L EAM + GVK +V Sbjct: 61 DRQLLCRIFREQTVDAVIHFAGLKAVGESVAQPLRYYECNVGGSLVLFEAMAEAGVKTLV 120 Query: 121 FSSSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPF 180 FSSSATVYG P PI EDFPL ATNPYG++KLMLE++L D+ AD++W +A LRYFNP Sbjct: 121 FSSSATVYGDPHAVPIREDFPLRATNPYGRSKLMLEEVLADMAAADSQWRIARLRYFNPV 180 Query: 181 GAHPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAE 240 GAH SG +GE PNGIPNNLMPYVAQVA G +LSVFGNDYPT DGTGVRD+IHVVDLA+ Sbjct: 181 GAHESGLLGEAPNGIPNNLMPYVAQVAAGLRARLSVFGNDYPTPDGTGVRDFIHVVDLAQ 240 Query: 241 GHVKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFA 300 GH+ AL + G NLGTG GYSVL++V+AFE SG+ +P+ F RRPGDIA C+A Sbjct: 241 GHLAALAALARGEGMLTVNLGTGRGYSVLDLVRAFEAASGRTIPFDFVPRRPGDIAACYA 300 Query: 301 DPAKAKRELGWEAKRGLEEMCADSWRWQSSNV 332 DPA A LGW A+R L MC D+WRWQ + V Sbjct: 301 DPALAASLLGWTARRDLAAMCRDTWRWQQTAV 332 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 337 Length adjustment: 28 Effective length of query: 311 Effective length of database: 309 Effective search space: 96099 Effective search space used: 96099 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate Dsui_0398 Dsui_0398 (UDP-glucose-4-epimerase)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.22412.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-136 438.7 0.0 6.5e-136 438.5 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_0398 Dsui_0398 UDP-glucose-4-epimeras Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0398 Dsui_0398 UDP-glucose-4-epimerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 438.5 0.0 6.5e-136 6.5e-136 2 328 .. 3 331 .. 2 334 .. 0.99 Alignments for each domain: == domain 1 score: 438.5 bits; conditional E-value: 6.5e-136 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavleeekidaviH 76 iLvtGg GyiGsh++++ll++g+ v +lDnls++ +++ +++ + + ++egd++d++ l ++++e+++daviH lcl|FitnessBrowser__PS:Dsui_0398 3 ILVTGGLGYIGSHTCVELLQAGHGVTILDNLSNSRADVAERIAGLGgaAPIFIEGDVRDRQLLCRIFREQTVDAVIH 79 9******************************************99888899************************** PP TIGR01179 77 faaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesplnpinpYGrsklmvE 153 fa+l+avgEsv++Pl+YYe nv ++l+L eam++agvk+l+Fsssa+vYg++++vpi E++pl ++npYGrsklm+E lcl|FitnessBrowser__PS:Dsui_0398 80 FAGLKAVGESVAQPLRYYECNVGGSLVLFEAMAEAGVKTLVFSSSATVYGDPHAVPIREDFPLRATNPYGRSKLMLE 156 ***************************************************************************** PP TIGR01179 154 rilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevavgkrekleifGtdyptkDGtcvRDyi 229 ++l d++ ad++++++ LRYFn++GA+e+g +Gea+++++ +l+++va+va+g r +l++fG+dypt+DGt+vRD+i lcl|FitnessBrowser__PS:Dsui_0398 157 EVLADMAAADSQWRIARLRYFNPVGAHESGLLGEAPNGIPnNLMPYVAQVAAGLRARLSVFGNDYPTPDGTGVRDFI 233 ****************************************9************************************ PP TIGR01179 230 HveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaGDpaslvadaskikrelg 306 Hv Dla++Hlaal al++g+++ + nlG+g+g+sv+++++a++++sg++i++ + +rR+GD+a+++ad++ + + lg lcl|FitnessBrowser__PS:Dsui_0398 234 HVVDLAQGHLAALAALARGEGMLTVNLGTGRGYSVLDLVRAFEAASGRTIPFDFVPRRPGDIAACYADPALAASLLG 310 ***************************************************************************** PP TIGR01179 307 wkpkyddLeeiiksawdWekkl 328 w++++d L+ +++++w+W+++ lcl|FitnessBrowser__PS:Dsui_0398 311 WTARRD-LAAMCRDTWRWQQTA 331 ***999.************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (337 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.26 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory