GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aacS in Dechlorosoma suillum PS

Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate Dsui_2069 Dsui_2069 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II

Query= reanno::acidovorax_3H11:Ac3H11_3009
         (578 letters)



>lcl|FitnessBrowser__PS:Dsui_2069 Dsui_2069 acyl-CoA synthetase
           (AMP-forming)/AMP-acid ligase II
          Length = 529

 Score =  194 bits (494), Expect = 6e-54
 Identities = 168/537 (31%), Positives = 243/537 (45%), Gaps = 45/537 (8%)

Query: 43  PEREALVSVHQG--------RRYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNAEW 94
           P++ AL++   G        R +TYAQL  E +R A ALL +G+  GD V  + +N   +
Sbjct: 19  PDKPALIAWEGGDHDTPAQRRVWTYAQLNAEVNRHAHALLALGVQKGDVVAAFLYNTPAF 78

Query: 95  VLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSMARFKTSDYLGMLRELAPEW 154
           V   LA A+VG V   IN  YR A  E A              F   D  G  + L  E 
Sbjct: 79  VFSLLAAARVGAVFNPIN--YRLAAQELA--------------FILED--GQAKVLLFEK 120

Query: 155 QGQQPGHLQAAKLPQLKTVVWIDDEAGQGADEPGLLRFTELIARGNAADPRLAQVAAGLQ 214
           +G +   ++ A+   + T  WI  ++   A      R  +L+    A  P +      ++
Sbjct: 121 EGCEV--VEKAREHGVPTAHWIYADS-DAAPAFATARLDQLVRHQPATLPPVI-----VE 172

Query: 215 ATDPINIQFTSGTTGFPKGATLTHRNILNNGFFIGECMKLTPADRLCIPVPLYHCFGMVL 274
             D   + +TSGTTG PKG   THR+ L +   + + M L+  D      PL H   +  
Sbjct: 173 ENDNCILMYTSGTTGRPKGVLHTHRSKLAHNAMMHQAMTLSREDVGLAVAPLNHTAELHT 232

Query: 275 GNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTGLHGVPTMFIAELDHPRFAEFNLSTL 334
             L     GAT V     FD     +  + E+ T     PTM    L HP  A  +LS+L
Sbjct: 233 SFLPRLQLGATQVLLRR-FDAGEAWRLTEVEKVTHFFAAPTMVTLLLHHPDVASRDLSSL 291

Query: 335 RTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTETSPVSCQSSTDTPLSKRVST-VGQV 393
           R     G+     +++   +++    + I YG TE  P          LS   S  +  +
Sbjct: 292 RLVEYGGASMAPHLIREWDKKVGAGLVQI-YGTTEMGPCMSVLYPHEQLSHAGSAGLPSL 350

Query: 394 QPHLEVKIVDPDTGAVVPIG-----QRGEFCTKGYSVMHGYWGDEAKTREAIDEGGWMHT 448
              L V  V  D     P       + GE   +G  +M GY         A+   GW HT
Sbjct: 351 NHDLLVARVKADGSPSDPADLAAPDEVGEILVRGPCMMGGYLNRPEANARAL-AFGWYHT 409

Query: 449 GDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPQVQDVQVVGVPDQKYGEE 508
           GDL ++D EGY+ I  RI  M+  G EN+YPRE+E+ L  HP V +V VVG PD  +G+ 
Sbjct: 410 GDLGSLDKEGYLWIRDRIDHMINSGAENVYPREVEDALVEHPGVLEVAVVGEPDDTWGQV 469

Query: 509 LCAWIIAKPGTQPTEDDIRAFC--KGQIAHYKVPRYIRFVTSFPMTVTGKIQKFKIR 563
           + A ++AKPG   T++ +  F     ++AHYK PR   F+ + P T +GKIQK  +R
Sbjct: 470 VAAHVVAKPGATLTQEALDHFLLEGDRLAHYKRPRRYHFIEALPKTTSGKIQKHLLR 526


Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 702
Number of extensions: 34
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 578
Length of database: 529
Length adjustment: 36
Effective length of query: 542
Effective length of database: 493
Effective search space:   267206
Effective search space used:   267206
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory