GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ilvE in Dechlorosoma suillum PS

Align aromatic-amino-acid transaminase TyrB; EC 2.6.1.57 (characterized)
to candidate Dsui_1904 Dsui_1904 aspartate/tyrosine/aromatic aminotransferase

Query= CharProtDB::CH_004054
         (397 letters)



>lcl|FitnessBrowser__PS:Dsui_1904 Dsui_1904
           aspartate/tyrosine/aromatic aminotransferase
          Length = 398

 Score =  525 bits (1353), Expect = e-154
 Identities = 268/397 (67%), Positives = 307/397 (77%), Gaps = 1/397 (0%)

Query: 1   MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLNAQP 60
           MF+ VDAYAGDPILTL+E F +D R+ KVNL IGLYY+E G IP L +V +AEA + A P
Sbjct: 1   MFEHVDAYAGDPILTLVETFHKDSRTTKVNLGIGLYYDEQGRIPLLGSVRQAEAAIAAAP 60

Query: 61  HGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFP 120
              S YLPMEG   YR  +  LLFGAD   LK  R+ATIQTLGGSGALKVGAD LKRYFP
Sbjct: 61  APRS-YLPMEGAADYRAVVQKLLFGADSAALKAGRIATIQTLGGSGALKVGADLLKRYFP 119

Query: 121 ESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLPARSIVLLHP 180
           +S  WVS+PTW+NH +IF GAG  V  YP+YD  T GV F  ++A LK LP +SIVLLHP
Sbjct: 120 KSEAWVSNPTWDNHRSIFEGAGIAVHDYPYYDANTGGVDFTGMVACLKGLPEQSIVLLHP 179

Query: 181 CCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPAL 240
           CCHNPTG DL+ +QW  VI I+  R+LIPFLDIAYQGFG G++EDAYAIRA+A +GLP L
Sbjct: 180 CCHNPTGVDLSREQWQQVIAIVAERKLIPFLDIAYQGFGDGLDEDAYAIRALADSGLPFL 239

Query: 241 VSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLN 300
           VSNSFSK  S YGERVGGLSV+C+DAE AGRVLGQLK TVRRNYSSPP  G  V   V+N
Sbjct: 240 VSNSFSKNLSFYGERVGGLSVVCKDAEEAGRVLGQLKFTVRRNYSSPPIHGELVTTIVMN 299

Query: 301 DEALKASWLAEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVD 360
           D AL A W+ EV EMRTRI AMRQ+L +VL+  +P ++F Y   QRGMFSYTGLS AQVD
Sbjct: 300 DAALHAEWVKEVTEMRTRIQAMRQKLYEVLTARVPGKDFSYFTKQRGMFSYTGLSPAQVD 359

Query: 361 RLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM 397
           RLREEFGVYL+ SGRMCVAGLNT NV  VA+A AAV+
Sbjct: 360 RLREEFGVYLVRSGRMCVAGLNTGNVAYVAEAMAAVL 396


Lambda     K      H
   0.320    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 489
Number of extensions: 11
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 397
Length of database: 398
Length adjustment: 31
Effective length of query: 366
Effective length of database: 367
Effective search space:   134322
Effective search space used:   134322
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory