Align methylcrotonoyl-CoA carboxylase (subunit 2/2) (EC 6.4.1.4) (characterized)
to candidate Dsui_0389 Dsui_0389 acetyl-CoA carboxylase, biotin carboxylase subunit
Query= BRENDA::Q9I299 (655 letters) >FitnessBrowser__PS:Dsui_0389 Length = 455 Score = 412 bits (1059), Expect = e-119 Identities = 221/431 (51%), Positives = 291/431 (67%), Gaps = 4/431 (0%) Query: 9 QRLLVANRGEIACRVMRSARALGIGSVAVHSDIDRHARHVAEADIAVDLGGAKPADSYLR 68 +++L+ANRGEIA RV R+ R LGI +V VHS+ DR A++V AD +V +G A A SYL Sbjct: 3 EKILIANRGEIALRVQRACRELGIKTVVVHSEADREAKYVKLADESVCIGPASSALSYLN 62 Query: 69 GDRIIAAALASGAQAIHPGYGFLSENADFARACEEAGLLFLGPPAAAIDAMGSKSAAKAL 128 II+AA + AQAIHPGYGFLSENADFA E +G +F+GP A I MG K +AK Sbjct: 63 IPAIISAAEVTDAQAIHPGYGFLSENADFAERVESSGFVFIGPRAETIRLMGDKVSAKDA 122 Query: 129 MEEAGVPLVPGYHGEA-QDLETFRREAGRIGYPVLLKAAAGGGGKGMKVVEREAELAEAL 187 M+ AGVP VPG G +D + + +GYPV++KAA GGGG+GM+VV EA L A+ Sbjct: 123 MKAAGVPCVPGSDGALPEDPKEIIKIGRAVGYPVIIKAAGGGGGRGMRVVHTEAALINAV 182 Query: 188 SSAQREAKAAFGDARMLVEKYLLKPRHVEIQVFADRHGHCLYLNERDCSIQRRHQKVVEE 247 + ++EA+ AFG+ + +EK+L PRHVEIQV AD + +YL ERDCS+QRRHQKV+EE Sbjct: 183 AMTRQEAQTAFGNPMVYMEKFLENPRHVEIQVLADEFKNAVYLGERDCSMQRRHQKVIEE 242 Query: 248 APAPGLGAELRRAMGEAAVRAAQAIGYVGAGTVEFLLDERGQFFFMEMNTRLQVEHPVTE 307 APAPG+ A L +GE A + IGY GAGT EFL E G+F+F+EMNTR+QVEHPVTE Sbjct: 243 APAPGIPARLIARVGERCAEACRRIGYRGAGTFEFLY-ENGEFYFIEMNTRVQVEHPVTE 301 Query: 308 AITGLDLVAWQIRVARGEALPLTQEQVPLNGHAIEVRLYAEDPEGDFLPASGRLMLYREA 367 ITG+D+V QIR+A GE L Q + GHAIE R+ AEDP F+P+ G + + Sbjct: 302 LITGIDIVQEQIRIAAGEKLRFKQRDIQFRGHAIECRVNAEDP-FTFVPSPGTISWW-HP 359 Query: 368 AAGPGRRVDSGVREGDEVSPFYDPMLAKLIAWGETREEARQRLLAMLAETSVGGLRTNLA 427 GPG RVDS G +V P YD M+ K+I +G+TRE+A +R+ L+ET V G++TN+ Sbjct: 360 PGGPGVRVDSHAYSGYKVPPHYDSMIGKIITFGDTREQAIRRMRIALSETVVQGIKTNIP 419 Query: 428 FLRRILGHPAF 438 + ++ F Sbjct: 420 LHQELMQDARF 430 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 714 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 655 Length of database: 455 Length adjustment: 35 Effective length of query: 620 Effective length of database: 420 Effective search space: 260400 Effective search space used: 260400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory