Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate Dsui_0841 Dsui_0841 ABC-type branched-chain amino acid transport systems, ATPase component
Query= TCDB::Q8DQH7 (236 letters) >FitnessBrowser__PS:Dsui_0841 Length = 251 Score = 218 bits (556), Expect = 7e-62 Identities = 113/236 (47%), Positives = 166/236 (70%), Gaps = 4/236 (1%) Query: 3 VLKVENLSVHYGMIQAVRDVSFEVNEGEVVSLIGANGAGKTTILRTLSGLVRPSSGKIEF 62 VL+V +L V YG ++A+ VS + EGE+V++IG NGAGKTT+L L GL+ P G++ + Sbjct: 10 VLEVSDLCVAYGKVEALHKVSLRIREGEIVTVIGPNGAGKTTLLSALMGLL-PYRGEVAY 68 Query: 63 LGQEIQK-MPAQKIVAGGLSQVPEGRHVFPGLTVMENLEMGAF--LKKNREENQANLKKV 119 + + + ++ V GL+ VPE R +F ++V +NL +GAF + ++ +++V Sbjct: 69 VSHNLDAHVEVEERVGQGLTLVPEKRELFAEMSVEDNLLLGAFHRYRSGLRDHAQTMEEV 128 Query: 120 FSRFPRLEERKNQDAATLSGGEQQMLAMGRALMSTPKLLLLDEPSMGLAPIFIQEIFDII 179 F+ FPRL+ER+ Q A TLSGGE+QMLAMGRALM+ PKLL+LDEPS+GLAP+ I+EIF I+ Sbjct: 129 FALFPRLKERRTQAAGTLSGGERQMLAMGRALMAKPKLLMLDEPSLGLAPLIIKEIFRIV 188 Query: 180 QDIQKQGTTVLLIEQNANKALAISDRGYVLETGKIVLSGTGKELASSEEVRKAYLG 235 ++++ G ++LL+EQNA AL ++D GYVLETG++ L G ELA V + YLG Sbjct: 189 AELKQTGVSILLVEQNARAALQVADYGYVLETGEVSLEGPSHELADDPRVIETYLG 244 Lambda K H 0.315 0.134 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 251 Length adjustment: 23 Effective length of query: 213 Effective length of database: 228 Effective search space: 48564 Effective search space used: 48564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory