Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate Dsui_0842 Dsui_0842 ABC-type branched-chain amino acid transport systems, ATPase component
Query= uniprot:A0A165KC86 (260 letters) >FitnessBrowser__PS:Dsui_0842 Length = 593 Score = 226 bits (575), Expect = 1e-63 Identities = 115/249 (46%), Positives = 164/249 (65%), Gaps = 2/249 (0%) Query: 8 VVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFE 67 V+L+ G++KRFGGL A D+ +T++ G+V LIGPNGAGK+T FN I+G+ P G Sbjct: 344 VLLQAEGVTKRFGGLVANKDMALTVQAGEVMALIGPNGAGKSTMFNCISGVNPPSEGRIS 403 Query: 68 LAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGF 127 G+P ++A+ G++RTFQ++RL + MT LENV +G H+R A R + Sbjct: 404 FLGQPVAGLEARDIARLGLSRTFQHVRLLSGMTVLENVAIGAHLRGRHNYLAAGLRLE-- 461 Query: 128 KAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAG 187 +AEEA + A ++ VG+ + A +L+ G QR +EIARALA DP L+ LDEPAAG Sbjct: 462 RAEEARLLAEAARQIERVGLAEHMFDAAGSLALGKQRIIEIARALAADPCLLLLDEPAAG 521 Query: 188 MNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKN 247 + EK L EL+ ++R + ILL+EHD+ VMGL DRV V+++G+++AEG P E+QKN Sbjct: 522 LRYLEKQALAELLRKLRGEGMGILLVEHDMDFVMGLADRVVVMEFGEKLAEGLPEEIQKN 581 Query: 248 EKVIEAYLG 256 V+EAYLG Sbjct: 582 PAVLEAYLG 590 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 593 Length adjustment: 30 Effective length of query: 230 Effective length of database: 563 Effective search space: 129490 Effective search space used: 129490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory