Align Amino acid ABC transporter, membrane protein (characterized, see rationale)
to candidate Dsui_0637 Dsui_0637 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family
Query= uniprot:Q88GX2 (236 letters) >FitnessBrowser__PS:Dsui_0637 Length = 224 Score = 97.4 bits (241), Expect = 2e-25 Identities = 73/208 (35%), Positives = 107/208 (51%), Gaps = 8/208 (3%) Query: 26 GLLVTAKLVAISFSLGAVLGLLLALARLSRSLVLQRMAAGYVYFFRGSPLLAQLFLLYYG 85 GLLVT ++ + +G G LLA+ARLS + +L +AAGYV FR PL+ + Y Sbjct: 19 GLLVTLEVTLTAIVVGIGWGTLLAVARLSSNRLLSFLAAGYVNLFRSVPLVMVILWFYLI 78 Query: 86 L-GSLKG-FWQDVGLWWFFRDAWFCTLLAFTLNTAAYQAEIFRGSLMAVAPGQHEAARAL 143 + +LKG F QD+G L+AF L AAY +EI R + +V GQ A AL Sbjct: 79 VPQALKGLFGQDIG-----DIRLVSALVAFALFEAAYYSEIIRAGIQSVPKGQVAAGLAL 133 Query: 144 NLKRSTTFFKVILPQSLLVAIGPLGNELILMIKASAIASLVTIYDLMGVTKLAFSRSFDF 203 L T V+LPQ+ I L + I++ + +++ ++ + D G R Sbjct: 134 GLTPGQTMRLVVLPQAFRNMIPLLLTQAIILFQDTSLVYVIGLSDFFGTAYKVGDRDGRL 193 Query: 204 -QIYLWAAVLYLVIVELVRRLLKHLEAR 230 ++ L+A Y VI V RL+KHL+AR Sbjct: 194 VELLLFAGAAYFVICFTVSRLVKHLQAR 221 Lambda K H 0.331 0.144 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 236 Length of database: 224 Length adjustment: 23 Effective length of query: 213 Effective length of database: 201 Effective search space: 42813 Effective search space used: 42813 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory