Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate Dsui_3464 Dsui_3464 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component
Query= uniprot:A8LLL2 (373 letters) >FitnessBrowser__PS:Dsui_3464 Length = 263 Score = 165 bits (417), Expect = 1e-45 Identities = 94/212 (44%), Positives = 131/212 (61%), Gaps = 8/212 (3%) Query: 1 MADLKLTGVEKAY----GDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKIT 56 M+D+ + V+K + GDV L +INL ++QGE + +GPSGCGKSTLL +AG + + Sbjct: 1 MSDILIKDVQKVFKTPGGDVTALKDINLTVKQGEFVCLLGPSGCGKSTLLNAVAGFQPPS 60 Query: 57 GGTLEIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEA 116 G + I+G + P RG MVFQ YAL+P MTV +N++F L+I KK +AEID V Sbjct: 61 AGEIVIEGKKIL-TPGPDRG--MVFQEYALFPWMTVAQNIAFGLQIQKKEKAEIDLTVNQ 117 Query: 117 AAEKLQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEI 176 + L L + DR PK LSGG RQRVAI R + D + L DEP LDA R + E+ Sbjct: 118 LLDLLHLKDFRDRFPKDLSGGMRQRVAIARVLALDSPIMLMDEPFGALDALTRRNLQDEL 177 Query: 177 AQLKEAMPESTMVYVTHDQVEAMTLATRIVVL 208 ++ E + T+++VTH E++ LA RIVV+ Sbjct: 178 LRIWEKL-NKTILFVTHSIEESIYLADRIVVM 208 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 263 Length adjustment: 27 Effective length of query: 346 Effective length of database: 236 Effective search space: 81656 Effective search space used: 81656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory