Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate Dsui_2943 Dsui_2943 ABC-type spermidine/putrescine transport system, ATPase component
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__PS:Dsui_2943 Length = 356 Score = 179 bits (454), Expect = 1e-49 Identities = 99/229 (43%), Positives = 134/229 (58%), Gaps = 7/229 (3%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTH----VAPRD 76 V I G L+GPSGCGK+T LR +AG E++ G+I + + V+ +AP Sbjct: 19 VDGIGFHIEAGVIACLLGPSGCGKTTLLRCIAGFEDIAAGSIALDGELVSRPGFKLAPEQ 78 Query: 77 RDIAMVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKAL 136 R I MVFQ+YAL+PH+TV +N+ F LK G E +RV +GL E+ P L Sbjct: 79 RRIGMVFQDYALFPHLTVADNIAFGLKTKG---GERQQRVAAMLDLVGLAGQGEKYPHEL 135 Query: 137 SGGQRQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQ 196 SGGQ+QRVA+ RA+ P++ L+DEP SNLD LR + ++ + +K G T + VTHDQ Sbjct: 136 SGGQQQRVALARALAPAPRLVLLDEPFSNLDVDLRERLSLEVREILKKAGTTAILVTHDQ 195 Query: 197 TEALTMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGT 245 EA M D I V+ +G +QQ P LY +PAN FVA F+G GT Sbjct: 196 HEAFAMADEIGVMHEGRIQQWDTPYNLYHQPANRFVADFVGQGVFVPGT 244 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 356 Length adjustment: 30 Effective length of query: 346 Effective length of database: 326 Effective search space: 112796 Effective search space used: 112796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory