Align mannitol dehydrogenase (EC 1.1.1.255) (characterized)
to candidate Dsui_2228 Dsui_2228 Zn-dependent alcohol dehydrogenase
Query= BRENDA::Q38707 (365 letters) >FitnessBrowser__PS:Dsui_2228 Length = 340 Score = 169 bits (429), Expect = 8e-47 Identities = 108/322 (33%), Positives = 162/322 (50%), Gaps = 21/322 (6%) Query: 40 VRLKVLFCGVCHSDHHMIHNNWGFT-TYPIVPGHEIVGVVTEVGSKVEKVKVGDNVGIGC 98 V +KV+ GVCH+D H +W + P +PGHE VG V VG+ V VK GD VG+ Sbjct: 32 VLVKVVASGVCHTDLHAADGDWPVKPSLPFIPGHEGVGYVAAVGAGVTHVKEGDRVGVPW 91 Query: 99 LVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMTHGGYSDTMVADEHFILRWPKNLPL 158 L +C CE C E+ C+ S G +GGY++ ++AD ++ + P L Sbjct: 92 LHTACGHCEHCITGWETLCD-------SQQMTGYTVNGGYAEYVLADPGYVGKLPDTLEF 144 Query: 159 DSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLGGLGHVAVKMAKAFGAQVTVIDISES 218 AP+LCAG+T Y LK KPG + + G+GGLGH+AV+ AKA G V +D+++ Sbjct: 145 APAAPVLCAGVTVYKGLKVLEC-KPGDWVAISGIGGLGHMAVQYAKAMGFHVIAVDVADE 203 Query: 219 KRKEALEKLGADSFL-------LNSDQEQMKGARSSLDGIIDTVPVNHPLAPLFDLLKPN 271 K A + LGAD L + Q+Q+KGA GI+ T +L Sbjct: 204 KLALA-KTLGADVTLNAARVDPVAEIQKQIKGAH----GILVTAVSRSAFGQALGMLHKR 258 Query: 272 GKLVMVGAPEKPFELPVFSLLKGRKLLGGTINGGIKETQEMLDFAAKHNITADVEVIPMD 331 G + +VG P F LP+F ++ K + G+I G K+ +E L FA + + ++ Sbjct: 259 GTMSLVGLPPGDFGLPIFDVVLNAKTVRGSIVGTRKDLEEALAFAGEGKVKTHYSTDRIE 318 Query: 332 YVNTAMERLVKSDVRYRFVIDI 353 +N R+ + R V++I Sbjct: 319 NINDIFGRMKAGHIDGRIVLNI 340 Lambda K H 0.319 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 340 Length adjustment: 29 Effective length of query: 336 Effective length of database: 311 Effective search space: 104496 Effective search space used: 104496 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory