Align Probable NADP-dependent mannitol dehydrogenase; MtDH; Mannitol 2-dehydrogenase [NADP(+)]; Short chain dehydrogenase/reductase; YlSDR; EC 1.1.1.138 (characterized)
to candidate Dsui_2312 Dsui_2312 3-hydroxybutyrate dehydrogenase
Query= SwissProt::Q6CEE9 (278 letters) >FitnessBrowser__PS:Dsui_2312 Length = 260 Score = 101 bits (251), Expect = 2e-26 Identities = 78/261 (29%), Positives = 128/261 (49%), Gaps = 21/261 (8%) Query: 31 LKGKVASITGSSSGIGFAVAEAFAQAGADVAIWYNSKPSDEK---AEYLSKTYGVRSKAY 87 L GK+A +TGS+SGIG AVA A A+ GA V + S+P+ E ++ +GV+ Sbjct: 2 LSGKIALVTGSTSGIGLAVARALARNGAAVML-NGSRPAAEAEGLRAAMAAEFGVKVAYT 60 Query: 88 KCAVTNAKQVETTIQTIEKDFGKIDIFIANAGIPWTAGPMIDVPNNEEWDKVVDLDLNGA 147 + +A V EK G +DI + NAGI A +D E+WD+++ ++L+ Sbjct: 61 SADLADAASVRALAAAAEKQLGVVDILVNNAGIQHVAA--VDEFPEEKWDQLIAINLSSV 118 Query: 148 YYCAKYAGQIFKKQGYGSFIFTASMSGHIVNIPQMQACYNAAKCAVLHLSRSLAVEWAGF 207 ++ K K + +G + AS G + + +A Y A+K AV+ S+++A+E A Sbjct: 119 FHATKAVLPGMKARNWGRIVNIASAHGLVAS--PFKAPYTASKHAVVGFSKAVALEVAET 176 Query: 208 A-RCNTVSPGYMATEISD----------FIPRD--TKEKWWQLIPMGREGDPSELAGAYI 254 CN V PGY+ T + + +P D ++ P R + +LA + Sbjct: 177 GITCNAVCPGYVRTPLVEKQVAAQAKVHNLPEDQVIRDVILAAQPNKRFLEADDLAEFVL 236 Query: 255 YLASDASTYTTGADILVDGGY 275 +L S A TGA + +DG + Sbjct: 237 FLCSPAGAGMTGAALPMDGAW 257 Lambda K H 0.317 0.132 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 260 Length adjustment: 25 Effective length of query: 253 Effective length of database: 235 Effective search space: 59455 Effective search space used: 59455 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory