GapMind for catabolism of small carbon sources

 

Aligments for a candidate for TM1749 in Dechlorosoma suillum PS

Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate Dsui_2799 Dsui_2799 oligopeptide/dipeptide ABC transporter, ATP-binding protein

Query= TCDB::Q9X271
         (324 letters)



>lcl|FitnessBrowser__PS:Dsui_2799 Dsui_2799 oligopeptide/dipeptide
           ABC transporter, ATP-binding protein
          Length = 670

 Score =  296 bits (757), Expect = 1e-84
 Identities = 152/319 (47%), Positives = 205/319 (64%)

Query: 1   MMELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINR 60
           M +LL+V NLK  F     ++ AVDG+S+ +  GE+  ++GESG GKS + L+LLRL+  
Sbjct: 1   MSDLLSVRNLKAGFLAGGRVLTAVDGVSFAVAPGETFALLGESGCGKSATALALLRLLPN 60

Query: 61  NGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWH 120
            GRI  GE    G+++L L +  +R+ RG   ++IFQ P TSLNP++ +G Q+ E +  H
Sbjct: 61  AGRIQGGEVWLEGEEILALPEAAMRDRRGSAAAMIFQEPATSLNPVLTIGRQIGESLERH 120

Query: 121 RLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADE 180
           R MK E AR  A+ LL  VGI +  +R   YPFQ SGGM+QR MIA+ALA  P+LLIADE
Sbjct: 121 RGMKGEAARREALALLTAVGIADPERRLEEYPFQLSGGMKQRAMIAIALAGEPRLLIADE 180

Query: 181 PTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVE 240
           PTTALDVTIQAQI++LL  L+ E  M ++ ITHDL V      R+  MYAG+IVE AP +
Sbjct: 181 PTTALDVTIQAQILDLLARLQAERAMGMLLITHDLGVVARSAHRVGVMYAGEIVETAPRQ 240

Query: 241 EILKTPLHPYTKGLLNSTLEIGSRGKKLVPIPGNPPNPTKHPSGCKFHPRCSFAMEICQR 300
           E   +P HPYT+ L  +  ++G RG +L  IPG  P     P+GC+F PRC  AM+ C+ 
Sbjct: 241 EFFASPRHPYTQKLFAALPDLGQRGAQLATIPGQVPGLAAMPAGCRFAPRCPVAMDRCRL 300

Query: 301 EEPPLVNISENHRVACHLI 319
           E P    +   H+V CH +
Sbjct: 301 ESPGWTELEAGHQVRCHWV 319



 Score =  241 bits (614), Expect = 5e-68
 Identities = 137/325 (42%), Positives = 202/325 (62%), Gaps = 19/325 (5%)

Query: 4   LLNVNNLKVEF-------HRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLR 56
           LL V  LKV F        R  G VKAVDG+S +L +G +L +VGESG GK+ +  ++LR
Sbjct: 351 LLAVGELKVHFPIRKGLFKRTVGHVKAVDGVSLELQRGRTLALVGESGCGKTTAGKAVLR 410

Query: 57  LINRNGRI-VDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVME 115
           L+   G + +DG      ++LL L + EL+ +R + + ++FQ+P  SLNP + VG  + E
Sbjct: 411 LLPATGSVRLDG------RELLGLPERELKPLRRR-MQMVFQDPFASLNPRLTVGEIIEE 463

Query: 116 PIIWHRLMKNEEARERAIE-LLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPK 174
            +   R+  + + R  A+  LLE VG+P   +    YP +FSGG RQR+ IA ALA  P+
Sbjct: 464 GMTALRVAASRDERRAALAALLESVGLPA--EALGRYPHEFSGGQRQRIAIARALAVQPE 521

Query: 175 LLIADEPTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIV 234
           LL+ DEPT+ALDV++QAQI+ LL+ L+EE G++ +FITH+ +V       +  MY G+IV
Sbjct: 522 LLVCDEPTSALDVSVQAQILNLLRRLQEELGLAYLFITHNFAVVEYLAHDVAVMYLGRIV 581

Query: 235 EEAPVEEILKTPLHPYTKGLLNSTLEIGSRG-KKLVPIPGNPPNPTKHPSGCKFHPRCSF 293
           E+ PV+++L  P HPYT+ LL++  E    G +++V +PG  P+P + P GC FHPRC+ 
Sbjct: 582 EQGPVQQVLAAPCHPYTRALLSAVPEPRLAGQREMVRLPGETPSPARPPQGCHFHPRCAQ 641

Query: 294 AMEICQREEPPLVNISENHRVACHL 318
           A E C++E P     +    V CHL
Sbjct: 642 ASERCRQEYPAPSTQAGGVVVRCHL 666


Lambda     K      H
   0.320    0.139    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 549
Number of extensions: 19
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 324
Length of database: 670
Length adjustment: 33
Effective length of query: 291
Effective length of database: 637
Effective search space:   185367
Effective search space used:   185367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory