Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate Dsui_2877 Dsui_2877 ABC-type antimicrobial peptide transport system, ATPase component
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__PS:Dsui_2877 Length = 248 Score = 114 bits (285), Expect = 2e-30 Identities = 80/240 (33%), Positives = 133/240 (55%), Gaps = 12/240 (5%) Query: 4 LLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGR 63 ++ V L + G + G+S ++ GE + I+G SGSGKS + +++L ++R Sbjct: 13 VIEVAGLDKAYDTPMGPFPVLKGVSLAIHAGEFVAIMGPSGSGKS-TFMNILGCLDRPS- 70 Query: 64 IVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRLM 123 G+ I GK + L+K++ +R + I +FQ +L P + + V P+++ + Sbjct: 71 --GGDYILDGKHVSALDKDQTALLRNRTIGFVFQG--FNLLPRMSLEDNVALPLVYCGVD 126 Query: 124 KNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPTT 183 K EE R+RA ELL +VG+ + K + P + SGG +QRV IA AL P+L++ADEPT Sbjct: 127 K-EERRQRARELLAKVGLGQYAK---SLPNRISGGQQQRVAIARALVNRPRLILADEPTG 182 Query: 184 ALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVEEIL 243 LD +IM L +EL E G++++ +TH+ +A + R + G+IV +AP L Sbjct: 183 NLDSHTSEEIMALFEELNRE-GITIVLVTHEPDIAQH-AKRQVRFLDGRIVHDAPTHHDL 240 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 248 Length adjustment: 26 Effective length of query: 298 Effective length of database: 222 Effective search space: 66156 Effective search space used: 66156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory