Align Iron-sulfur cluster-binding protein, putative (characterized, see rationale)
to candidate Dsui_3044 Dsui_3044 NADH-quinone oxidoreductase, chain G
Query= uniprot:Q39TW6 (218 letters) >FitnessBrowser__PS:Dsui_3044 Length = 776 Score = 92.8 bits (229), Expect = 2e-23 Identities = 63/205 (30%), Positives = 97/205 (47%), Gaps = 31/205 (15%) Query: 4 INLQIDGKEVVATEGMTILDAAKSVGISIPTLCHHEKLEPYGGCRICTVEVEVRGWPKLV 63 + ++IDGK+ +G T++DAA+ VG+ IP C+H+KL CR+C V+VE PK + Sbjct: 2 LEIEIDGKKAEVPDGSTVMDAAQQVGVYIPHFCYHKKLSIAANCRMCLVQVEKA--PKPL 59 Query: 64 AGCIYPVEKGLVVRTRNEKIDKIRKVLLEEMLAHAP---------DSEELKALAQEYGAD 114 C PV G+ V T +E K +K ++E +L + P +L+ L+ YG Sbjct: 60 PACATPVTNGMKVFTHSELAVKAQKGVMEFLLINHPLDCPICDQGGECQLQDLSVGYGGV 119 Query: 115 RDRFEKHP-----------------SFCIHCGLCVRYCAEIKKKNAVGFVDRGSNREI-S 156 + R+++ S CIHC CVR+ EI +G +R + EI + Sbjct: 120 KSRYQEEKRVVFHKDIGPLISMEEMSRCIHCTRCVRFGQEIAGIMELGMANRNFHSEITT 179 Query: 157 FIPEIAAKECWDCKECFPLCPTSAL 181 F+ E LCP AL Sbjct: 180 FMARTVDSEL--SGNAIDLCPVGAL 202 Lambda K H 0.320 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 218 Length of database: 776 Length adjustment: 31 Effective length of query: 187 Effective length of database: 745 Effective search space: 139315 Effective search space used: 139315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory