Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate Dsui_0977 Dsui_0977 acyl-CoA dehydrogenase
Query= BRENDA::Q3JP94 (395 letters) >FitnessBrowser__PS:Dsui_0977 Length = 378 Score = 206 bits (525), Expect = 7e-58 Identities = 125/372 (33%), Positives = 204/372 (54%), Gaps = 2/372 (0%) Query: 18 LADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGGPGL 77 L ++ M+RD+ A+AQ +LAP E ++ T A +E+GE+G +G +PE++GG G+ Sbjct: 3 LTQEQEMIRDSMRAFAQERLAPFAAEWDKNHTFPAEALKELGELGAMGMCVPEEWGGAGM 62 Query: 78 DYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIGCFG 137 DY+S L E+ D +++SVQ+SL ++G+D QKE++L LA GE +GCF Sbjct: 63 DYMSLVLTLEEIAAGDGATSTIVSVQNSLACGITQKYGTDQQKEEWLKPLARGEKLGCFC 122 Query: 138 LTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLDE-DGRDEIRGF 196 LTEP+ GSD ++ TRA + + L+G K +IT A + +V+A D+ G+ I F Sbjct: 123 LTEPHTGSDAAAITTRADRDGDHFVLNGVKQFITTGKHAHMAIVFAVTDKAAGKKGISCF 182 Query: 197 ILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENIL-PHVKGLRGPFTCLNSARY 255 ++ KG K+G AS T +I+ ++ VP +L +G + + L + R Sbjct: 183 LVPTDTKGFIVGRTEEKMGQHASDTVQIIFEDCRVPASALLGKEGEGYKIALSNLEAGRI 242 Query: 256 GIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGR 315 GIA ++G A + + A +Y +R FG+P+ +Q + +LADM T + V R Sbjct: 243 GIAAQSIGMARAAFEAAVRYAKERVTFGQPIIEHQAVNFRLADMNTLLDAARLMVWRAAA 302 Query: 316 MKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEG 375 +KD G ++ S+ K + A IA A + GG G + +F V R ++ + YEG Sbjct: 303 LKDAGKPCLKEASMAKMFASEAAEKIASDAIQIHGGVGYTSDFPVERIYRDVRISQIYEG 362 Query: 376 THDIHALILGRA 387 +DI L++GR+ Sbjct: 363 ANDIQRLVIGRS 374 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 378 Length adjustment: 30 Effective length of query: 365 Effective length of database: 348 Effective search space: 127020 Effective search space used: 127020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory