GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ARO8 in Dechlorosoma suillum PS

Align Aromatic-amino-acid aminotransferase (EC 2.6.1.57) (characterized)
to candidate Dsui_2433 Dsui_2433 aspartate/tyrosine/aromatic aminotransferase

Query= reanno::Cup4G11:RR42_RS33490
         (400 letters)



>lcl|FitnessBrowser__PS:Dsui_2433 Dsui_2433
           aspartate/tyrosine/aromatic aminotransferase
          Length = 402

 Score =  424 bits (1091), Expect = e-123
 Identities = 210/396 (53%), Positives = 271/396 (68%)

Query: 1   MFEHIDAYPGDPILSLNESFQLDPRTDKVNLSIGIYFDDEGRLPVMQAVREAEAALMADM 60
           +F  ++  P DPIL L E+F  D R  KVNL +G+Y+DD G++P++ AV+ AE A +  M
Sbjct: 5   IFASVEMAPRDPILGLTEAFNADTRATKVNLGVGVYYDDNGKIPLLAAVKAAEKARLETM 64

Query: 61  GPRPYLPMAGFAAYRDAVQALVFGQPCQARAEGRIATVQTLGGSGALRVGADFLKRYFPD 120
            PR Y P+ G  AY  AVQ L+FG   +  A GR+ T + LGG+GAL++GADFLKR  P+
Sbjct: 65  PPRGYQPIEGLNAYNQAVQNLLFGAGSELLAAGRVITAEALGGTGALKIGADFLKRISPN 124

Query: 121 AQVWISDPSWENHRVIFERTGFTVNTYPYYDDATGGLKFDAMLDALRLIPKRSIVLLHAC 180
           A+V+ISDPSWENHR +FE  GF V  YPYYD AT G+ F  M   L  +   SI++LHAC
Sbjct: 125 AKVYISDPSWENHRALFESAGFVVENYPYYDAATRGVNFAGMKSFLEGLAAGSIIILHAC 184

Query: 181 CHNPTGVDLNHDQWRQLITLLKQHELLPFVDMAYQGFGAGLDDDAFAVRELVAQGVPCLV 240
           CHNPTG DL+  QW++++ + K   L+PF+DMAYQGF  G+D DA AVR   A G+   V
Sbjct: 185 CHNPTGADLSDAQWQEVVDVCKAKGLVPFLDMAYQGFADGIDADAVAVRAFSASGLQFFV 244

Query: 241 ANSFSKNFSLYGERCGGLSVVCDSAEETGRVLGQLTGAVRANYSNPPTHGARVVARVLTT 300
           ++SFSK+FSLYGER G LSVV  S EE+ RVL Q+   +R NYSNPPTHG  VVA VL+T
Sbjct: 245 SSSFSKSFSLYGERVGALSVVTASKEESARVLSQVKRVIRTNYSNPPTHGGAVVAAVLST 304

Query: 301 PALRTIWERELAGKCERIAKMRAAIHKGLAAHVSGEALSRYLTQRGMFTYTGLTADQVDR 360
           P LR +WE ELAG  +RI  MR A+   L A    +  S  + QRGMF+YTGLT+ QVD 
Sbjct: 305 PELRQMWEDELAGMRDRIRAMRVALVDKLKAKGVAQDFSFVVKQRGMFSYTGLTSAQVDV 364

Query: 361 LRTEHGVYLLRSGRMCVAGLNERNVTQVAQAIASVL 396
           LR E G+Y + +GR+C+A LN +N+  V  AIA+VL
Sbjct: 365 LRNEFGIYAVGTGRICLAALNSKNIDAVVDAIAAVL 400


Lambda     K      H
   0.323    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 445
Number of extensions: 13
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 402
Length adjustment: 31
Effective length of query: 369
Effective length of database: 371
Effective search space:   136899
Effective search space used:   136899
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory