Align Putative pterin-4-alpha-carbinolamine dehydratase; PHS; EC 4.2.1.96; 4-alpha-hydroxy-tetrahydropterin dehydratase; Pterin carbinolamine dehydratase; PCD (uncharacterized)
to candidate Dsui_3224 Dsui_3224 pterin-4a-carbinolamine dehydratase
Query= curated2:Q47IX1 (112 letters) >FitnessBrowser__PS:Dsui_3224 Length = 111 Score = 104 bits (260), Expect = 3e-28 Identities = 49/104 (47%), Positives = 66/104 (63%) Query: 6 NLADRQCTPCEGGIAPLENSVAAVMLDTLPGWTLDGQRLDKTYVFRNHYEAMAFVNAIAW 65 +LA C G L+++ A++L LPGW+ + + KT+ F + AM F N +AW Sbjct: 5 DLARDTCRHLSGPQHRLDDATVAMLLPLLPGWSREDGHIAKTFHFTGYEAAMLFANGVAW 64 Query: 66 VSHRENHHPELIVGYKDVRVRYWTHAIGGLSENDFICAAKLEKL 109 ++ R+NHHPEL V Y VRV Y TH +GGLS NDFICAAK+E L Sbjct: 65 LAQRQNHHPELQVNYNTVRVTYGTHDVGGLSRNDFICAAKIEAL 108 Lambda K H 0.322 0.136 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 48 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 112 Length of database: 111 Length adjustment: 12 Effective length of query: 100 Effective length of database: 99 Effective search space: 9900 Effective search space used: 9900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory