GapMind for catabolism of small carbon sources

 

Aligments for a candidate for bamH in Dechlorosoma suillum PS

Align Benzoyl-CoA reductase electron transfer protein, putative (characterized, see rationale)
to candidate Dsui_3045 Dsui_3045 NADH-quinone oxidoreductase, F subunit

Query= uniprot:Q39TW5
         (635 letters)



>lcl|FitnessBrowser__PS:Dsui_3045 Dsui_3045 NADH-quinone
           oxidoreductase, F subunit
          Length = 442

 Score =  346 bits (887), Expect = 1e-99
 Identities = 175/404 (43%), Positives = 255/404 (63%), Gaps = 4/404 (0%)

Query: 150 SMDDYLAIGGYSALSKVLFQMTP-EDVMGEIKKSNLRGRGGGGFPAWRKWEESRNAPDPI 208
           S+ DY+A GGY AL K+L +  P E V+ E+K S LRGRGG GFP   KW     +    
Sbjct: 22  SLKDYVARGGYEALKKILAEKIPQEQVIAEVKTSVLRGRGGAGFPTGLKWSFMPRSFPGD 81

Query: 209 KYVIVNADEGDPGAFMDRALIEGNPHSILEGLIIGAYAVGAHEGFIYVRQEYPLAVENIN 268
           KYV+ N+DEG+PG F DR ++  NPHS++EG+ I AYA+GA  G+ Y+  E     +   
Sbjct: 82  KYVVCNSDEGEPGTFKDRDILRYNPHSVIEGMAIAAYAMGATRGYNYIHGEIWEVYKRFE 141

Query: 269 LAIRQASERGFVGKDILGSGFDFTVKVHMGAGAFVCGESSALMTALEGRAGEPRPKYIHT 328
            A+ +A   GF+G++ILGSGF+F +  H G GA++CGE +AL+ ++EG+ G+PR K    
Sbjct: 142 DALDEARAAGFIGQNILGSGFNFELFAHHGYGAYICGEETALLESIEGKKGQPRFKPPFP 201

Query: 329 AVKGVWDHPSVLNNVETWANVTQIITKGADWFTSYGTAGSTGTKIFSLVGKITNTGLVEV 388
           A  G++  P+ +NN ET+ ++  II  G + F + G   + GTK+FS+ G +   G  E+
Sbjct: 202 ASFGLYGKPTTINNTETFGSIPFIIRDGGEKFLNLGKPNNGGTKLFSISGHVNRPGNYEI 261

Query: 389 PMGVTLRDIITKVGGGIPGGKKFKAVQTGGPSGGCIP-EAMLDLPVDFDELTKAGSMMGS 447
           P+G     ++ ++ GG+ GG+K KAV  GG S   +P + M++  +D+D ++KAGSM+GS
Sbjct: 262 PLGTPFSTLL-EMAGGVRGGRKLKAVIPGGSSAPVLPGDVMMECTMDYDSISKAGSMLGS 320

Query: 448 GGMIVMDEDTCMVDIARYFIDFLKDESCGKCTPCREGIRQMLAVLTRITVGKGKEGDIEL 507
           G +IVMDE TCMV        F  +ESCG+CTPCREG   +  V++RI  G G+  D++L
Sbjct: 321 GAVIVMDETTCMVKALERLSFFYHEESCGQCTPCREGTPWLYKVVSRIEHGLGRPDDLDL 380

Query: 508 LEELAES-TGAALCALGKSAPNPVLSTIRYFRDEYEAHIREKKC 550
           L+ + E   G  +CALG +A  PV S I++FRDE+  HI  K C
Sbjct: 381 LDSVCEGIMGRTICALGDAAAFPVKSFIKHFRDEFVHHIEHKTC 424


Lambda     K      H
   0.319    0.138    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 811
Number of extensions: 33
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 635
Length of database: 442
Length adjustment: 35
Effective length of query: 600
Effective length of database: 407
Effective search space:   244200
Effective search space used:   244200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory