Align indolepyruvate ferredoxin oxidoreductase (subunit 1/2) (EC 1.2.7.8) (characterized)
to candidate Dsui_0094 Dsui_0094 2-oxoacid:ferredoxin oxidoreductase, gamma subunit
Query= BRENDA::Q6LZB5 (188 letters) >FitnessBrowser__PS:Dsui_0094 Length = 205 Score = 113 bits (283), Expect = 2e-30 Identities = 67/186 (36%), Positives = 101/186 (54%), Gaps = 3/186 (1%) Query: 2 NIVIAAVGGQGAVLASKILGTLAQNLGKDVKVSEVHGMSQRGGSVVAYVKFGEKVYSPVV 61 NI++ +GGQG + A++IL A LG DVK +EV GM+QRGG V ++++FG KV SP + Sbjct: 7 NILVVGIGGQGVMTATEILAEAAIALGHDVKKTEVAGMAQRGGVVSSHLRFGPKVLSPQI 66 Query: 62 EKGTADIVLAFEMLEGARYVDYLKENGKLVVNTQKIDPMPVITGDVKYPSDLNEKFEKLN 121 GTA ++L FE E R+ L G ++NT ++ P V G YP+D + Sbjct: 67 TPGTAHVLLGFEAAEAMRWRHMLVPEGIALMNTAQLTPPVVDLGLYDYPADPVGSMKDSG 126 Query: 122 IGYVPVDALSIAKNAGTLKAVNVALIGVLAKNSNIKKEEWIKAIKDTVP---EKFLELNL 178 V DA++IAK+ G ++ N ++G +A + + + I EK +E N Sbjct: 127 CRVVAFDAMAIAKDLGDIRLGNTVMLGAVADHLPFSADILLNCILQRFARKGEKVVEQNR 186 Query: 179 KAFEMG 184 KAF G Sbjct: 187 KAFAAG 192 Lambda K H 0.315 0.135 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 92 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 188 Length of database: 205 Length adjustment: 20 Effective length of query: 168 Effective length of database: 185 Effective search space: 31080 Effective search space used: 31080 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory