Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate Dsui_2807 Dsui_2807 enoyl-CoA hydratase/carnithine racemase
Query= BRENDA::P76082 (255 letters) >FitnessBrowser__PS:Dsui_2807 Length = 262 Score = 129 bits (324), Expect = 6e-35 Identities = 82/242 (33%), Positives = 128/242 (52%), Gaps = 10/242 (4%) Query: 15 LTLNRPAARNALNNALLMQLVNELEAAATDTSISVCVITGNARFFAAGADLNEMA---EK 71 L LNRPA N+L+NA+L L+ EL++ A D ++ V V+ G + F AG DL EM +K Sbjct: 20 LVLNRPAQFNSLSNAMLETLLAELQSIAADKTVRVVVLQGAGKAFCAGHDLKEMRSNHDK 79 Query: 72 DLAATLNDTRPQLWARLQAFNKPLIAAVNGYALGAGCELALLCDVVVAGENARFGLPEIT 131 L ++ +Q +P+IA ++G A AGC+L +CD+ VA + A+F + I Sbjct: 80 AFMQALFKLCAKVMLTIQEMPQPVIARIHGIATAAGCQLVSMCDLAVAADVAKFAVSGIN 139 Query: 132 LGIM---PGAGGTQRLIRSVGKSLASKMVLSGESITAQQAQQAGLVSDVFPSDLTLEYAL 188 +G+ P G L R++G+ A +M+L+GE I A +AQ+ GLV+ V E Sbjct: 140 VGLFCSTPAVG----LARNMGRKEALEMLLTGEFIDAGEAQRRGLVNRVVALGDLDEAVE 195 Query: 189 QLASKMARHSPLALQAAKQALRQSQEVALQAGLAQERQLFTLLAATEDRHEGISAFLQKR 248 L + SP+A+ KQ + E+ ++A ++ D EGI AF++KR Sbjct: 196 HLVQSILAKSPVAVATGKQMFYKQLEMGIEAAYQYAGEVMACNMMAGDAAEGIDAFIEKR 255 Query: 249 TP 250 P Sbjct: 256 KP 257 Lambda K H 0.318 0.130 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 100 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 262 Length adjustment: 24 Effective length of query: 231 Effective length of database: 238 Effective search space: 54978 Effective search space used: 54978 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory