GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaH in Dechlorosoma suillum PS

Align 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35); enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate Dsui_0318 Dsui_0318 3-hydroxyacyl-CoA dehydrogenase

Query= BRENDA::Q0KEG0
         (807 letters)



>lcl|FitnessBrowser__PS:Dsui_0318 Dsui_0318 3-hydroxyacyl-CoA
           dehydrogenase
          Length = 795

 Score =  852 bits (2200), Expect = 0.0
 Identities = 443/808 (54%), Positives = 558/808 (69%), Gaps = 19/808 (2%)

Query: 2   SNFIVKKVAVLGAGVMGAQIAAHLINARVPVVLFDLPAKEGPKNGIALRAIENLKKLSPA 61
           S  IV++ AVLGAGVMGAQIAAHL NA VPVVLFDL AKEG  NGI  +A++ LKKL PA
Sbjct: 5   SKLIVRRAAVLGAGVMGAQIAAHLANADVPVVLFDLAAKEGDPNGIVKKALDGLKKLDPA 64

Query: 62  PLGIKEEAGLIQAANYEDDIALLKECDLVIEAIAERMDWKHDLYKKVAPHLASHAIFATN 121
           PL  KE    I AANYE  +ALL ECDLVIEAIAE+M+WK DLY+K+APHL + AI A+N
Sbjct: 65  PLASKERLAHIDAANYEQHLALLGECDLVIEAIAEKMEWKEDLYRKIAPHLKAGAIVASN 124

Query: 122 TSGLSITALSDGFDADLKSRFCGVHFFNPPRYMHLVELIPTATTQPQILDQLEAFLTTTL 181
           TSGLSI  LS    A+ ++ FCG+HFFNPPRYM LVE+I T  + P +LD+LE +L + L
Sbjct: 125 TSGLSINKLSSTVPAEKRANFCGIHFFNPPRYMPLVEIIATTDSDPAMLDRLETWLVSRL 184

Query: 182 GKGVVRAKDTPNFIANRVGIFSILAVFAEAEKFGIPFDVVDDLTGSKLGRAKSATFRTAD 241
           GK VVRAKDTPNF+ANRVG+FSILAV    ++  + FD VD LTG K+GR KSAT+RTAD
Sbjct: 185 GKSVVRAKDTPNFVANRVGVFSILAVMHHTQRLEMGFDEVDALTGPKIGRPKSATYRTAD 244

Query: 242 VVGLDTMAHVIKTMQDTLHDDPFAPVYKTPAVLKGLVDAGALGQKTGAGFYKKEGKAIKV 301
           VVGLDT+AHV+KTMQDTL  DP+   ++ PA L  L++ GALGQKT  G ++K+GK I+V
Sbjct: 245 VVGLDTLAHVVKTMQDTLPGDPWHSHFQAPAWLAALIEKGALGQKTKCGIFRKQGKEIQV 304

Query: 302 LD-AKTGQYVDAGKKADEIVVRMLKKDAAERIKLLRESTNPQAQFLWAVFRDVFHYIAVY 360
           LD AK      AG+ A E+   +  K+ AE+   LR S++ QAQFLWA++RDVFHY A +
Sbjct: 305 LDLAKQDYRTSAGEIAPEVAEILKIKNPAEKFAALRASSHKQAQFLWAIYRDVFHYCAFH 364

Query: 361 LEQIAGSAADIDLAIRWGFGWNSGPFEDWQSAGWKQVAEWVKEDVEAGKALSAAPLPAWV 420
           LE IA +A D+D A+RWGFGW  GPFE WQ+AGWK +A  V+ D++AG A+S APLPAWV
Sbjct: 365 LESIADNARDVDFAMRWGFGWAMGPFETWQAAGWKAIAAAVQADIDAGLAMSTAPLPAWV 424

Query: 421 FEGPVAENQGVHAAAGSWSPATQSFVARSKLPVYQRQAFRAAIKGTAAADPRKAGRTVEE 480
                    GVH  AGSWS A Q    RS LPVY RQ +   + G A   P   G TV E
Sbjct: 425 M-----ARDGVHEPAGSWSAAEQGLKPRSALPVYGRQLYPETVLGEA---PAAKGETVWE 476

Query: 481 NDAVRIWVSEGQDDVLVVSFKSKMNTIGPDVIDGLTRAIDLAEAGYKGLVVWQPTSLQLG 540
           N  VR+W       + ++S  SKM+ IG +V+DG+  A+  AE  + GLV+W        
Sbjct: 477 NAGVRLWTHAQDPKIAILSITSKMHAIGDEVLDGVLEAVSRAERDFDGLVIWHE------ 530

Query: 541 APGGPFSAGANLEAAMPAFMMGGAKGIEPFVKRFQDGMMRVKYASVPVVSAASGIALGGG 600
               PF+ GANL+    A   G    +E  V +FQ   M  K+A VP V+A  G+ALGGG
Sbjct: 531 ---APFAVGANLQQVGEACAKGEFDKLEATVAKFQRASMAFKHAQVPTVAAVQGMALGGG 587

Query: 601 CELMLHSASRVAALETYIGLVEVGVGLVPAGGGLKEAALAAARAAQAAGSTNILQFLTSR 660
           CE ++H+A RV ALE+Y+GLVE GVGL+PAGGG KE A+ AA+         +  FL + 
Sbjct: 588 CEFVMHAAHRVMALESYVGLVEAGVGLIPAGGGCKEFAIRAAQFGARQAGGELFPFLQNV 647

Query: 661 FQSAAMAKVSASALEARQMGYLQPSDKIVFNVHELLYVAQNEVRALASAGYRAPLPTL-V 719
           FQ+ AMAKV+ SALE ++MG+ + +D IVFN  ELL+VA    RA+A+AGYR PL    +
Sbjct: 648 FQTIAMAKVAKSALEVQEMGFGKEADDIVFNAQELLFVAIARARAMAAAGYRPPLRARNI 707

Query: 720 PVAGRSGIATIKASLVNMRDGGFISTHDFLIASRIAEAVCGGDVEAGSLVSEDWLLALER 779
           PVAGR GIAT++  LVNM++GGFIS HD+ +A   A A+CGGDVE GS V ++WLL +ER
Sbjct: 708 PVAGRPGIATLEMMLVNMKEGGFISAHDYRVARSAAIALCGGDVEQGSRVDDEWLLTVER 767

Query: 780 KAFVDLLGTGKTQERIMGMLQTGKPVRN 807
           + FV+LL T +TQ RI  ML+TGKP+RN
Sbjct: 768 REFVELLKTPETQARIKHMLETGKPLRN 795


Lambda     K      H
   0.319    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1525
Number of extensions: 61
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 807
Length of database: 795
Length adjustment: 41
Effective length of query: 766
Effective length of database: 754
Effective search space:   577564
Effective search space used:   577564
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory