GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ1 in Dechlorosoma suillum PS

Align 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase; EC 2.3.1.174; EC 2.3.1.223 (characterized)
to candidate Dsui_0325 Dsui_0325 acetyl-CoA acetyltransferase

Query= SwissProt::P0C7L2
         (401 letters)



>lcl|FitnessBrowser__PS:Dsui_0325 Dsui_0325 acetyl-CoA
           acetyltransferase
          Length = 432

 Score =  235 bits (599), Expect = 2e-66
 Identities = 161/429 (37%), Positives = 236/429 (55%), Gaps = 43/429 (10%)

Query: 5   FICDGIRTPIGRYGGALSSVRADDLAAIPLRELLVRNPRLDAECIDDVILGCANQAGEDN 64
           ++ DG RTP  +         A DLA    R LL R P    E +D+V+LGCA+ +  D 
Sbjct: 11  YVVDGARTPFLKAKNGPGPFSAADLAVQAGRALLARQP-FAPEDLDEVVLGCASPS-PDE 68

Query: 65  RNVARMATLLAGLPQSVSGTTINRLCGSGLDALGFAARAIKAGDGDLLIAGGVESMSRAP 124
            N+ R+A L  G    V+G T+ R C SG+ AL  A   I++G  +L++AGGV+++SRAP
Sbjct: 69  VNIGRVAALRLGCGNKVTGWTVMRNCASGMQALDSAMANIQSGRSELVLAGGVDALSRAP 128

Query: 125 FVMGKAASA-FSRQAEMFDTTIGWR-----------FVNPLMAQQFG-TDS-----MPET 166
            +   A    F+   +M   T+G +            +NP++    G TD      M +T
Sbjct: 129 LLYNDAMVLWFAGMMQM--KTLGQKAGHFLKLRPSVLLNPVIGLMKGLTDPVVGLLMGQT 186

Query: 167 AENVAELLKISREDQDSFALRSQQRTAKAQSSGILAEEIVPVVLKNKKGVVTEIQHDEHL 226
           AEN+A    ISRE+ D+F++RS QR    ++     E IVP+V  +     T    D+ +
Sbjct: 187 AENLAWRFGISREEMDAFSVRSHQRVMAGRAKQAFGE-IVPLVGNDG----TVYAEDDGV 241

Query: 227 RPETTLEQLRGLKAPF-RANGVITAGNASGVNDGAAALIIASEQMAAAQGLTPRARIVAM 285
           R + +++ ++ LK  F +  G +T  N+S + DG A L++ASE       L P  RIV  
Sbjct: 242 RVDASMDGMKKLKPFFDKKYGRVTPANSSQITDGGAWLLLASESAVKRWKLEPLGRIVDA 301

Query: 286 ATAGVEPRLMGLGPVPATRRVLERAGLSIHDMDVIELNEAFAAQALGVLR---------- 335
             AG++P  MGLGPV A   +L+R GL ++D+D++E+NEAFAAQ LG L+          
Sbjct: 302 QWAGLDPSQMGLGPVHAVTPILQRHGLGLNDVDLMEINEAFAAQVLGCLKAWEDDAYCRE 361

Query: 336 ELGLPD-----DAPHVNPNGGAIALGHPLGMSGARLALAASHELHRRNGRYALCTMCIGV 390
           ELGLP      D   +N +GGA+A GHP+G SGAR+ L   H L  R G+  + ++CIG 
Sbjct: 362 ELGLPGALGSLDQDKLNVDGGAVAQGHPVGASGARIVLHLLHALKARGGKRGVASICIGG 421

Query: 391 GQGIAMILE 399
           GQG AM++E
Sbjct: 422 GQGGAMLVE 430


Lambda     K      H
   0.319    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 491
Number of extensions: 24
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 432
Length adjustment: 31
Effective length of query: 370
Effective length of database: 401
Effective search space:   148370
Effective search space used:   148370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory