GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ2 in Dechlorosoma suillum PS

Align Beta-ketoadipyl CoA thiolase (EC 2.3.1.-) (characterized)
to candidate Dsui_0317 Dsui_0317 acetyl-CoA acetyltransferase

Query= reanno::Marino:GFF2751
         (415 letters)



>lcl|FitnessBrowser__PS:Dsui_0317 Dsui_0317 acetyl-CoA
           acetyltransferase
          Length = 399

 Score =  308 bits (789), Expect = 2e-88
 Identities = 188/415 (45%), Positives = 245/415 (59%), Gaps = 30/415 (7%)

Query: 7   LKDAYIVDAIRTPIGRYGGALSAVRADDLGAIPIKALAERYPDLDWSKIDDVLYGCANQA 66
           ++DAYIV A R P+ +  G     R DD+ A  +K++  + P LD + ++DV+ GCA   
Sbjct: 5   IQDAYIVAATRLPVAKRNGMFKTTRPDDMLAHALKSVMAQVPQLDPALVEDVIVGCAMPE 64

Query: 67  GEDNRDVARMSLLLAGLPVDVPGSTINRLCGSGMDAVGSAARAIRTGETQLMIAGGVESM 126
            E   +VAR+ LLLAGLP  VPG TINR C SG+ AV  AA  IR GE  +M+A G E+M
Sbjct: 65  AEQGMNVARIGLLLAGLPDTVPGLTINRFCSSGVQAVADAAARIRLGEADVMLAAGTETM 124

Query: 127 SRAPFVMGKADSAFSRKAEIFDTTIGWRFVNPVLKKQYGIDSMPETAENVAADFGISRED 186
           S    +MG   +  S    IF+        +  +   YG   M  TAE VA  +GISR+D
Sbjct: 125 SLMSQMMG---NKVSLNPAIFEK-------DENVAIAYG---MGLTAEKVAQKWGISRDD 171

Query: 187 QDAFALRSQQRTAAAQKEGRLAAEITPVTIPRRKQD---------PLVVDTDEHPR-ETS 236
           QDAFA+ S Q+  AA   G+   EI+P T+     D           V DTDE PR ++S
Sbjct: 172 QDAFAVASHQKAVAAIAAGKFKDEISPYTVRAHLPDLKSGTVRIVEKVCDTDEGPRPDSS 231

Query: 237 LEKLASLPTPFRENGTVTAGNASGVNDGACALLLAGADALKQYNLKPRARVVAMATAGVE 296
           L+ LA L   F   G+VTAGN+S ++DGA A+LL     LKQ+NL+P AR    + AGV 
Sbjct: 232 LQGLAKLKPVFNARGSVTAGNSSQMSDGAGAVLLVSEKILKQFNLQPLARFAGFSVAGVP 291

Query: 297 PRIMGFGPAPATRKVLATAGLELADMDVIELNEAFAAQALAVTRDLGLPDDAEHVNPNGG 356
           P IMG GP  A  KVLA AG++  D+D IELNEAFAAQALAVTR+LGL  D   +NP GG
Sbjct: 292 PEIMGIGPIAAIPKVLAQAGIKQDDLDWIELNEAFAAQALAVTRELGL--DPAKINPQGG 349

Query: 357 AIALGHPLGMSGARLVTTALNELERRHAAGQKARYALCTMCIGVGQGIALIIERM 411
           AIALGHPLG +GA    T ++ + R     +  ++ + TMCIG G G A + E +
Sbjct: 350 AIALGHPLGATGAIRTATLVHGMRR-----ENKKWGMVTMCIGTGMGAAGLFEAL 399


Lambda     K      H
   0.318    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 427
Number of extensions: 18
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 415
Length of database: 399
Length adjustment: 31
Effective length of query: 384
Effective length of database: 368
Effective search space:   141312
Effective search space used:   141312
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory