GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaK in Dechlorosoma suillum PS

Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate Dsui_3212 Dsui_3212 acyl-CoA synthetase (AMP-forming)/AMP-acid ligase II

Query= BRENDA::A7KUK6
         (562 letters)



>lcl|FitnessBrowser__PS:Dsui_3212 Dsui_3212 acyl-CoA synthetase
           (AMP-forming)/AMP-acid ligase II
          Length = 555

 Score =  185 bits (469), Expect = 5e-51
 Identities = 164/568 (28%), Positives = 258/568 (45%), Gaps = 59/568 (10%)

Query: 10  VDIPEVDLWTFLFERKDRAYPDDKIIYQDADTQRHYTYKSLRDASLDFGKGLKALYEWRK 69
           VD+ E      LFE+    Y D ++ Y +       TY  L   S DF   L+ + +  +
Sbjct: 17  VDVNEFKSLGQLFEQSCAQYRD-RVAYINMGVG--ITYGELDRLSRDFAAYLQDVLKLPQ 73

Query: 70  GDVLALFTPNSIDTPVVMWGTLWAGGTISPANPGYTVDELAFQLKNSHAKGLVTQASVLP 129
           G  +AL  PN +  PV M+G L AG  +   NP YT  EL  QLK+S A+ +V   +   
Sbjct: 74  GARVALMMPNLLQYPVCMFGALRAGYVVVNCNPLYTHRELEHQLKDSGAEAIVIVENFAH 133

Query: 130 VAREAAKKV-GMPEDRIILIGDQRDP------DARVKHFTSVRNISGATRYRKQKITPAK 182
              +A   V G+    +  +GD          +  V+H   +       R+ K K   A+
Sbjct: 134 TLEQALPLVPGLKHVIVTSLGDMLGALKGTVVNLVVRHVKKMVPAWKLPRHVKFKAAMAR 193

Query: 183 --------------DVAFLVYSSGTTGVPKGVMISHRNIVANIRQQ------FIAEGEML 222
                         D+A+L Y+ GTTGV KG M+ HRNI+AN++Q       F+ + + L
Sbjct: 194 GKGATLRPVQVGHEDIAYLQYTGGTTGVAKGAMLLHRNIIANLQQAHAWIEPFLHKDQQL 253

Query: 223 SWNGGPDGKGDRVLAFLPFYHIYGLTCLITQALYKGY-HLIVMSKFDIEKWCAHVQNYRC 281
                       ++  LP YHI+ LT      L  G  ++++ +  DI  +   +  Y+ 
Sbjct: 254 ------------IITALPLYHIFSLTANCLTFLKIGATNVLITNPRDIPGFVKELAQYKF 301

Query: 282 SFSYIVPPVVLLLGKHPVVDKYDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLS 341
           +    V  +   L  +P   K D S+LR    G   + + + +         + + YGL+
Sbjct: 302 TVITGVNTLFNALLNNPDFAKLDFSALRAALGGGMAVQKSVAQKWRQVTGKPLIEAYGLT 361

Query: 342 ETSPTTHSQRWEDWREAMGSVGRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNV 401
           ETSP        D  E  G++G  +P    + +   + G++   +  G+ GE+ ++GP V
Sbjct: 362 ETSPAATINPL-DLGEFNGAIG--LPISSTEIVIRDDLGND---LPVGQAGEICIRGPQV 415

Query: 402 FLGYHENPEATKGCLSEDGWFQTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGY 461
             GY   P+ T      DG+ +TGDVG  D KG   I DR K++I   GF V P E+E  
Sbjct: 416 MKGYWLRPDETATVFYADGFLRTGDVGVMDEKGFVRIVDRKKDMILVSGFNVYPNEVEAV 475

Query: 462 LVDNDAIDDVAVIGIESETHGSEVPMACVVRSAKSKSSGTSEKDEAARIIKWLDSKVASH 521
           +  + A+ +VA +G+ SE  G  V +  V++      S T E     ++I      +  +
Sbjct: 476 VAMHPAVMEVAAVGVPSEHSGEAVKIFVVLKD----KSVTKE-----QLIAHCKENLTGY 526

Query: 522 KRLRGGVHFVDEIPKNPSGKILRRILKQ 549
           K +   V F D++PK   GKILRR LK+
Sbjct: 527 K-VPHLVEFRDDLPKTNVGKILRRALKE 553


Lambda     K      H
   0.317    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 662
Number of extensions: 34
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 562
Length of database: 555
Length adjustment: 36
Effective length of query: 526
Effective length of database: 519
Effective search space:   272994
Effective search space used:   272994
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory