Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate Dsui_0629 Dsui_0629 branched-chain amino acid ABC-type transport system, permease component
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__PS:Dsui_0629 Length = 307 Score = 287 bits (735), Expect = 2e-82 Identities = 153/310 (49%), Positives = 216/310 (69%), Gaps = 14/310 (4%) Query: 1 MEYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSL 60 M+ FLQQ+INGL LG+IY L+A+GYTMVYGI+G+INFAHGE+ MIGA AL + Sbjct: 1 MDIFLQQIINGLVLGSIYALVALGYTMVYGILGLINFAHGEVVMIGALTALTVVKLLAGS 60 Query: 61 GITWVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQI 120 G+ +AL+ ++ A+ + A+ G+ +E+IAYRPLR +PRLAPLI+AIG+SI LQN + Sbjct: 61 GLPGPVIALIGLMAAAPVCMAI-GYGIEKIAYRPLRKAPRLAPLITAIGVSIVLQNLAMM 119 Query: 121 LQGARSKPLQPILPGNLTLMDGAVSVSYVRLATIVITIA--LMYGFTQLITRTSLGRAQR 178 + G +LP + GA ++ L I++ +A +M G LI RT LGRA R Sbjct: 120 VWGRSYHSFPAVLPAEAHEVLGA---TFTDLQVIIVLVAAGMMAGLLLLINRTRLGRAMR 176 Query: 179 ACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFTA 238 A ++ +A L+GVNV+ +ISLTFV+G+ALAAVAG+MV Y + +Y+GF+ G+KAFTA Sbjct: 177 ATAENPAIAQLMGVNVNHIISLTFVIGSALAAVAGLMVSANYSIAHYYMGFILGLKAFTA 236 Query: 239 AVLGGIGSLPGAMLGGVVIGLIEAFWSGY--------MGSEWKDVATFTILVLVLIFRPT 290 AVLGGIG+L GAM+GG+++GLIE+ +GY +GS ++DV F +L+LVL+FRP+ Sbjct: 237 AVLGGIGNLAGAMIGGILLGLIESLGAGYIGDITGGFLGSHYQDVFAFFVLILVLVFRPS 296 Query: 291 GLLGRPEIEK 300 GL+G E+ Sbjct: 297 GLVGEKVAER 306 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 307 Length adjustment: 27 Effective length of query: 274 Effective length of database: 280 Effective search space: 76720 Effective search space used: 76720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory